KEGG   Coccidioides immitis: CIMG_01553Help
Entry
CIMG_01553        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cim  Coccidioides immitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cim00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 619 aa AA seqDB search
MMLSILRALYAVPLVYSLVSGSEAKFALRQEETLEQWLETESSYALQSILDNIGDDGAKV
QGAHAGIVVASPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQ
TVSNPSGTLSTGGLGEPKFHVDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDA
AKSIVWPVVQNDLSYVGQFWNSTGFDLWEEVQGSSFFTAIAQHRALAEGNNLARQLGTDC
PHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLLGIIHNFDPEADCDDNTFQPC
SSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLATFASAELLYD
AIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK
YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCL
ATSAAGSYQTATITGWPSTLTPTPTPTNPAPCPTPSSVKITFQSVTDTKWGENIFLVGSI
PELGSWEPSAAKQLKADKYEASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRS
YTVPKKCGVSSLVLKSTWR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatgctatccatcctcagagcgttatacgccgtccctctggtctatagcctggtcagc
ggttcggaggcaaagttcgcactgcggcaagaagagaccttggagcaatggcttgaaacg
gagagctcatatgccctccaatctattcttgacaatatcggggacgacggggcgaaagtg
cagggtgctcatgctggtattgtcgttgcgagcccgagcagggctgatccggattatttt
tatacatggactcgagacgccgccctcgtcttcaaacacctaatcgatgcttttgttgct
ggaaaccatgactcgcaggatcgcatccacgaatatatcaccgctcaatcatatttacag
accgtgtcgaatccgtctggaactttgtcgactggtggacttggtgagccaaagtttcat
gtggatcaatctgcgttcacagggagctgggggcggcctcaggcagacgggccggctctg
agagctactgcgatgattacctacgcgaaatggcttatcgccaatgggcatgaagatgcc
gcgaaatccatcgtatggcctgtcgtgcagaatgatctgtcgtacgttggccagttctgg
aactctactggatttgacctatgggaagaagttcagggatcgtcgttcttcacggcaatc
gcacaacatcgtgcgctcgcagaaggcaacaatcttgcccgccagcttgggacggattgt
cctcactgcgagtcgcaagcaccacaaatactttgcttcttgcagtcattctggaccggg
tccaacatcatcgcgaatttcgggggagacagatccggtcttgacgcaaactcccttctt
ggcatcatccataacttcgatccagaggcggattgcgatgataatacattccagccgtgc
tcgtcgagagcacttgcgaatcacaagaaggttacggattcttttcgtgaaatatacccg
ataaattctggcatggaaggtgatcaggctgttgccgttggtcgatatgctgaagatgtt
tactatggaggacagccgtggtacctcgcgacgtttgcctctgccgagctcttgtatgat
gctatttaccaatggaatcatacgggcaagattaccatcaccgatgtgtcattgccattt
ttccaaagcatttacaagtcagctcaggttggaacttattcctcctcaactaatgtcttc
tctgagatcattgccaatgtcgggagctatgccgacgggtacttgaatgttgcaagaaaa
tacacgccttgctctggggcactagctgagcagttctcaagaaacgatgggacaccacta
tctgcgagtgacctgacttggtcgtacgctgctcttttgacagcaaaagagagacgggaa
tcggttgtgccgggatcatggggtcaaaaatctgcgcacgacgttccaccgacctgcttg
gcaacatcggcggctggaagttatcaaaccgcgaccataacagggtggccttcaactctg
actccaactccaactccaaccaacccggcaccatgcccaaccccaagcagtgtcaaaatc
actttccagtcggtcaccgacacaaaatggggcgaaaacatttttctcgttgggtctatt
ccagaattaggatcatgggagcccagtgcggcaaaacaactgaaagcggacaagtacgaa
gcctcttgccccctgtggtccattcagattgatctcgccgcggggaagaaattcgattac
agatatatccggaagagtgacgacggaagggtagtgtgggagagtgatccgaatcgatca
tataccgtcccgaagaagtgcggagtttcgtctctggttctgaagagcacttggcgctga

DBGET integrated database retrieval system