KEGG   Coccidioides immitis: CIMG_01582Help
Entry
CIMG_01582        CDS       T01114                                 

Definition
(RefSeq) glycerol kinase
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cim  Coccidioides immitis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CIMG_01582
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CIMG_01582
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIMG_01582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 642 aa AA seqDB search
MYNSLVSLPAEKGMLPITAFQSLCQYNPFLSSIQSVPLKFYNLPQIYCLENRFLCRIPQF
VLPKFALAERSRIITSRINLSKVIGDLGMAGATVMPIRSQLGRDIDSSQVSQATPARGPF
IADHSKPQRRFVGAIDQGTTSTRFIIFDDQGNLVASYQTELSRLHKYPGWHEQDPKEIIS
SVESCIAQATKTFVNLGHSISDIQALGITNQRETTVVWDWETGEPLHSAIAWPDTRTASL
VRELKSKEGADQLQEKCGLPLSTYPSSVKLTWLLRNCKEVKEAYEAGRLAFGTVDTWLLY
NLNGGRKRGVFVTDVTNASRTMFTNLHTLQYDDSLLKFFDIDRSKLKLPKILASSDESAF
GCMADGLLAGIRITSCLGDQSASLVGHGALTPGTAKNTYGTGCFLLYNVGETPVISKHGL
LATVAFQLGSKQKPIYALEGSIAVAGSGVSFLMNNLGFFRDSRKVDEEAATVPDNGGCIF
VTAFSGLFAPYWVDDAKGTIFGITHHTQRGHIARATLEAVCFQTKAILEAMERDSGQTLS
DLAVDGGLSNSDICMQSQANIIRIPVERPPMHEVTALGAAIAAGLAVGVWRNLDELVGMN
KSNRTVFEAQISEAESARMYKQWSKAVRMSRGWLESDEIDAI
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtataatagtctcgtctcgctgccggccgagaagggcatgctccctattactgccttt
caatctctgtgccaatacaaccccttcctctcttccatccaaagtgtgccgctcaaattt
tacaacctacctcaaatctattgcctggaaaaccggtttctgtgtcgcataccccagttt
gtgctcccaaaatttgcgctggctgagcgcagtcgcatcataacatccaggataaatctt
agcaaggtaataggcgatttggggatggctggagcaactgtcatgccaattcgaagtcag
ctaggccgtgatatcgacagctctcaagtcagccaagcaaccccggcccggggtccattc
atagcggatcatagtaagcctcaacgtcggttcgttggcgcaatcgatcagggaacaacc
agcactcgttttatcatatttgatgatcaagggaacctcgtcgcttcgtatcagacagag
ctaagccgcctacataaatacccaggatggcatgagcaggacccaaaagagattatttca
tccgtcgaatcctgcatcgcacaggcaacgaagacttttgtcaacctggggcactccatc
tcagatattcaagctttggggattaccaaccagcgcgaaacaaccgtggtatgggactgg
gaaaccggagaacccctccatagcgcaatcgcatggccggatacccgcacagcctcgctg
gtgcgggaattaaagtcaaaagaaggtgcagatcagcttcaggaaaaatgcgggttacct
ctatccacgtatccgtcttctgtgaaactcacttggctccttcggaattgcaaagaggtc
aaggaggcgtatgaagcgggaagactggcctttggaactgttgacacatggctgctctat
aacctcaatggtggcaggaaaaggggagtattcgtcaccgatgtcacgaatgcctcgaga
acaatgttcaccaacctgcacacacttcagtatgatgattcgttgctgaaattcttcgat
atcgacagatcaaaactgaagcttccgaaaatccttgcttcttcggacgagtccgctttt
ggatgcatggcagacggcctgcttgcaggaattagaataacaagctgtcttggtgaccaa
tcggcttcattggtgggacatggggcgttgacgccaggcaccgcaaaaaatacctatggg
acgggatgtttccttttatataatgtaggtgaaacgccggtgatctcgaagcacgggctc
ctggcaactgtcgccttccaattgggctcgaagcagaagcctatatatgcattggaggga
agcatcgccgttgctggcagcggtgtgtcattcttgatgaataacttgggcttctttcgt
gactcgagaaaggtcgacgaggaagctgccaccgttcctgataatggtggctgcattttc
gtcacggcgttcagtggcctctttgctccatattgggtggatgacgccaaaggaactatc
tttgggatcacacatcacacacaaagaggtcatatagcccgggcaactcttgaagcagtc
tgtttccagacaaaagctatattggaggctatggaacgcgacagcggccagacactttct
gacttggcggtagacggcggattgagcaattcagacatctgcatgcagtcccaagcaaat
ataatccgtatccctgtcgagcgcccgcctatgcacgaagtcaccgcattaggtgcagct
attgcagcagggcttgccgtcggcgtgtggcgcaacctcgacgagttagtagggatgaat
aagtccaacaggaccgtattcgaagctcaaatcagcgaggcagagagcgccaggatgtac
aaacagtggtcgaaagccgtccgaatgtctcgtggatggctggagagcgacgaaatcgac
gccatttga

DBGET integrated database retrieval system