KEGG   Coccidioides immitis: CIMG_01582Help
Entry
CIMG_01582        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cim  Coccidioides immitis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cim00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 548 aa AA seqDB search
MPIRSQLGRDIDSSQVSQATPARGPFIADHSKPQRRFVGAIDQGTTSTRFIIFDDQGNLV
ASYQTELSRLHKYPGWHEQDPKEIISSVESCIAQATKTFVNLGHSISDIQALGITNQRET
TVVWDWETGEPLHSAIAWPDTRTASLVRELKSKEGADQLQEKCGLPLSTYPSSVKLTWLL
RNCKEVKEAYEAGRLAFGTVDTWLLYNLNGGRKRGVFVTDVTNASRTMFTNLHTLQYDDS
LLKFFDIDRSKLKLPKILASSDESAFGCMADGLLAGIRITSCLGDQSASLVGHGALTPGT
AKNTYGTGCFLLYNVGETPVISKHGLLATVAFQLGSKQKPIYALEGSIAVAGSGVSFLMN
NLGFFRDSRKVDEEAATVPDNGGCIFVTAFSGLFAPYWVDDAKGTIFGITHHTQRGHIAR
ATLEAVCFQTKAILEAMERDSGQTLSDLAVDGGLSNSDICMQSQANIIRIPVERPPMHEV
TALGAAIAAGLAVGVWRNLDELVGMNKSNRTVFEAQISEAESARMYKQWSKAVRMSRGWL
ESDEIDAI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcgaagtcagctaggccgtgatatcgacagctctcaagtcagccaagcaacc
ccggcccggggtccattcatagcggatcatagtaagcctcaacgtcggttcgttggcgca
atcgatcagggaacaaccagcactcgttttatcatatttgatgatcaagggaacctcgtc
gcttcgtatcagacagagctaagccgcctacataaatacccaggatggcatgagcaggac
ccaaaagagattatttcatccgtcgaatcctgcatcgcacaggcaacgaagacttttgtc
aacctggggcactccatctcagatattcaagctttggggattaccaaccagcgcgaaaca
accgtggtatgggactgggaaaccggagaacccctccatagcgcaatcgcatggccggat
acccgcacagcctcgctggtgcgggaattaaagtcaaaagaaggtgcagatcagcttcag
gaaaaatgcgggttacctctatccacgtatccgtcttctgtgaaactcacttggctcctt
cggaattgcaaagaggtcaaggaggcgtatgaagcgggaagactggcctttggaactgtt
gacacatggctgctctataacctcaatggtggcaggaaaaggggagtattcgtcaccgat
gtcacgaatgcctcgagaacaatgttcaccaacctgcacacacttcagtatgatgattcg
ttgctgaaattcttcgatatcgacagatcaaaactgaagcttccgaaaatccttgcttct
tcggacgagtccgcttttggatgcatggcagacggcctgcttgcaggaattagaataaca
agctgtcttggtgaccaatcggcttcattggtgggacatggggcgttgacgccaggcacc
gcaaaaaatacctatgggacgggatgtttccttttatataatgtaggtgaaacgccggtg
atctcgaagcacgggctcctggcaactgtcgccttccaattgggctcgaagcagaagcct
atatatgcattggagggaagcatcgccgttgctggcagcggtgtgtcattcttgatgaat
aacttgggcttctttcgtgactcgagaaaggtcgacgaggaagctgccaccgttcctgat
aatggtggctgcattttcgtcacggcgttcagtggcctctttgctccatattgggtggat
gacgccaaaggaactatctttgggatcacacatcacacacaaagaggtcatatagcccgg
gcaactcttgaagcagtctgtttccagacaaaagctatattggaggctatggaacgcgac
agcggccagacactttctgacttggcggtagacggcggattgagcaattcagacatctgc
atgcagtcccaagcaaatataatccgtatccctgtcgagcgcccgcctatgcacgaagtc
accgcattaggtgcagctattgcagcagggcttgccgtcggcgtgtggcgcaacctcgac
gagttagtagggatgaataagtccaacaggaccgtattcgaagctcaaatcagcgaggca
gagagcgccaggatgtacaaacagtggtcgaaagccgtccgaatgtctcgtggatggctg
gagagcgacgaaatcgacgccatttga

DBGET integrated database retrieval system