KEGG   Coccidioides immitis: CIMG_01704Help
Entry
CIMG_01704        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CIMG_01704
Peptidases [BR:cim01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CIMG_01704
Transcription machinery [BR:cim03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CIMG_01704
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 490 aa AA seqDB search
MADAVISVTPEFGCEHLREIFESNSRTAGQFYDSLLLVRESQSSLPQVFRELPQPRSAST
RRLSFKPLYQCLHCPVSRSRDGRAAHREMTGHLFFADCRSGSIWCQGCDDFIYDSEVDRV
LWDTSRIIRRTDSTSEKRTIAETLANPDTEDASYLTSNSSKRLCGKDGVRGLYNLGQTCY
MNVIMQTLFHEPLLTSYFLGHGHRIYDCSEANCFVCQVAETFAEFNNDEKQEGFNCLNLL
LSSWQSSPDLAGYQQQDAHEFYQFLVNKLHATAEDRVDGYDQRCRCFFHKAFFGKLQSSV
TCHNCGNTNRTEDPIMDLSLAFQVQRKKKALHWTPGESDTTPTLNGCLESYTAPEELPAS
DYSCSWCGTPQGATKQLRLRNLPVILCMQLKRFERHRSVSEKVDAKVSFPLSINMAPYTT
RSHSKNVLKYTYDLLSVVVHIGDIDSGHYLAYCRQGELWFKFNDDRVTWATEAEVLDADA
YLLFYTLRSL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgctgttattagcgtgacaccagaatttggctgtgaacacctcagggaaata
tttgagagcaactctagaactgctggccagttctacgactcccttctccttgtgcgggaa
tcccagtcctcgctacctcaagtgttccgggagcttcctcagccacgctccgcttccaca
cgacggttgtctttcaaaccattatatcagtgcctgcactgcccggttagtcgatcgcgg
gacggtcgagcggctcatcgggagatgaccggtcatttattcttcgctgattgccgaagt
gggtcaatatggtgtcaaggctgtgatgacttcatatacgacagtgaggtggacagggta
ctatgggatacgtctagaataatccggcgcacggattcgacttcagagaagcgcactatt
gctgagactctagccaaccctgatacagaggacgcttcctacttgacatctaacagtagc
aaacgactctgtgggaaggatggcgtgagaggcttgtataaccttggccagacgtgttac
atgaacgttattatgcagacattgttccatgagcccctgctcacatcttattttctcgga
cacggtcatcgcatctatgactgttccgaggcgaactgttttgtgtgccaagttgcagag
acattcgcagaatttaataacgatgaaaaacaagaaggattcaactgcctgaatctgctg
ttgagttcatggcaatcatcccctgaccttgccgggtatcaacaacaagatgcccatgaa
ttctatcagtttcttgtcaataaactccatgccacagccgaggatcgagttgacggatat
gaccagagatgccgatgcttcttccataaagcctttttcggcaagttgcaaagcagcgtg
acttgccataactgtggaaacacaaaccgcactgaagacccaatcatggacctaagtctt
gctttccaggtacagaggaagaagaaagcattgcattggacgcctggagagtcggatacg
acgccaaccctcaacggctgcttagagagctacacagctcctgaagaattgcctgcgagc
gattacagttgcagctggtgcggaacaccgcaaggggctacgaagcaacttagacttcga
aatttgccggtgatattatgcatgcagctcaagcggtttgagcgacatcgctccgtctcg
gagaaggtagacgccaaagtttctttcccgctgtcgataaacatggcgccgtacaccaca
cgctctcactctaaaaatgtcttgaagtatacctatgacttgctaagtgtggtagtccac
ataggggacattgactctggtcactatcttgcttattgccggcagggcgaactgtggttt
aagttcaacgatgatcgagttacgtgggctactgaggcggaggtgctggatgccgacgct
tatctgttattctataccttgcgctctctttaa

DBGET integrated database retrieval system