KEGG   Coccidioides immitis: CIMG_01783Help
Entry
CIMG_01783        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CIMG_01783
Peptidases [BR:cim01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CIMG_01783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1188 aa AA seqDB search
MLKFPKPRIFGRPGKTSPRFIQDVLCYDPATPSGQGFNLLTDVPPVWGDANDYPEFVAPN
HCPHRYLTKPNQTKLPQDISTLCCGNVFKVSAVLDEHLLRERMEEALKLCPDRLEGISHP
LPITVLATLKAYIDIALNEPERSRGIDLGNKRFTTSFGVRGTPCKDLLEFIGFKLKSSLL
PYHHPERIFLDDLSNELLALMKQRPEHEKEAYFLDFSAEAASTQFSYLLGSNNYSRMYTF
PINGSRESQPPFYQDLGATEDMSSELIIEAYRNQVQCDPDRSSYYFKCLRSIGHWRGELE
GKTIAEFIEEQYAEGKYADDDIPDAYRFFQLDINDRSLSDETIIGSFFARLEDSPNEAEP
RRQLARIGDYRRSQAIKSVAEESVSDMQQALVFLGAEQDTPDDFIISMYAAKVDDMPATK
ELAKRALSLIAEERKSEHLRYFLRTGDAQSDEMDIGEAYRLFQISDRTVDDDSILAAFQV
FATEDPAQIETYRKALKVISDETQSLLLKKALGEDLTPDNFDLKEWPVGLRNIGNTCYLN
SLLQFYFTVTPFRNMIFHFEKQKMELDDESLRRKKVGSRTVSRSEVERAQKFIRELRSLF
QNMASSPTRCVTPSQELARLTLLSSSNEAAIRRKSLAEPNLPVYGPFLPPDVDLNSNAGS
SLATRPIKGQGSEDSEATLVPPSDPSSVEIGIDNKENVQPQEPGAVVESTAAAPANGPAA
AQEGSTRRPMNPPDRPPPVPPRPVPDSVKKELEIGAQQDVTEVINNVLFQAQCAVKPEGY
DADGGQLDIVTELFYGKTKSYITTSDGVRCKEEPWSDIKVDVARQSSDIYSALDGAFDMQ
RVHIGGVEAEQHGTISKAPPILQIQIQRVQFDQVQMQSFKSNNHLELRETIYLDRYMDTP
LDDKIHRKRQEKWRLKDELQRLEKRRDELYNKANQPLPEVFDMLGNKLQVFMDLQESSKI
NDDGLGVEESTIALVSRFEEATEDEILWIDKRIAELGWHLENTFAEDERVPYRLYAVFIH
RGSASAGHYWIYIFDFEKKIWREYNDEQVLEIKKLSTIFAPETGPHSPSPYFLVYVNDPL
KEKLTNPVCRAVRDLPSPDLPTNTVDPPPFKTSEEQMDRHARPPTREPVKGKQQPADGVA
QQDLEMSDAPPSYEDVTSMNNKGVNVSAREISPSPSPSPPSNPLKRKH
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtttccgaaaccacgtatctttgggcgaccagggaagacctccccccgcttc
atccaagatgttctctgctacgacccggcaaccccctcagggcaaggattcaatctcctc
acagatgtcccgccggtttggggggatgccaatgactatccagaatttgtcgcacccaat
cactgccctcatcgttacctaaccaagccaaaccagacaaaactcccacaggacatcagc
acactatgttgcggtaatgtcttcaaggtttctgcggttttagacgagcatctattgaga
gagcgcatggaagaagctttgaagctttgccctgatcgcttggaaggaatcagtcatccg
cttcctatcacagtcttggccactctaaaagcatatatcgacattgcattgaatgagccg
gaaagaagccgcggaatagatcttgggaataaacgcttcacaacatcatttggtgtcaga
gggacaccttgcaaagacctcttagaattcataggattcaaattgaagtcttctctcctg
ccatatcaccaccccgaacgcatattccttgacgacctttcgaatgaattgcttgccttg
atgaaacagcgccccgagcatgaaaaggaggcgtacttcctggatttttcggcggaagca
gcttccacccagtttagttacctgcttggctcaaacaattattcaaggatgtatacgttt
cctatcaatggctcaagagaatcccaacccccgttttaccaggacttgggagcgacagag
gatatgtcgagcgaactgatcatcgaagcttatcggaatcaggtccagtgtgatccggat
cgaagctcttactatttcaaatgtctccgctccatcggccattggaggggggaactcgag
ggcaaaaccatcgccgaattcatcgaagagcaatacgcagagggaaaatacgccgacgat
gacattccggacgcctatcggtttttccagcttgatatcaatgatagaagcctctccgat
gagactataataggatctttttttgcacgactagaggactctcccaatgaggcagaaccg
agaaggcagcttgcaaggattggcgattatcgccgtagtcaggcgataaaatcagttgca
gaagaaagtgtatcggacatgcaacaggcccttgtgttcctcggtgccgaacaagatacg
cctgacgacttcatcatctccatgtatgctgcaaaggtcgacgatatgcctgccactaaa
gaacttgctaagcgtgcgctgtcattaatcgcggaagaaagaaaatctgagcaccttcga
tacttccttcgtacgggcgatgcacaatcagatgaaatggatattggcgaagcttatcga
ctctttcagatatctgaccgtacagtagatgacgattctatccttgcggcgtttcaagtc
ttcgccacggaggatcccgcacagatcgaaacttaccgaaaggcccttaaggttatttca
gatgagacccagagcttattgctgaagaaggcgcttggtgaagatctcactccagacaat
ttcgaccttaaagaatggccagtgggtctacgcaatatcggcaacacatgttacctcaac
agcctacttcaattctattttacggtgacgccttttcggaatatgatctttcactttgaa
aaacaaaaaatggagctggacgacgaaagcttacggcgcaagaaagtcggatcgcgaaca
gtttccagatctgaagtcgaacgggcccaaaaatttattcgcgaactacgctcgcttttt
cagaacatggcgtcttccccgacacgttgtgtgactccgagccaggaacttgcgagattg
acgcttcttagctcttcaaacgaggccgcaattcgacgtaaatccctagctgaaccaaat
ttgccagtttacggtcctttcttaccacccgatgttgaccttaatagtaatgctggttca
tctctggccacacgacctatcaaaggacaaggtagtgaagatagcgaggcaacccttgtt
cccccttctgacccaagtagtgtcgaaatcggaatcgacaataaagagaatgtacagcct
caagaacccggggctgttgttgagtctacagctgccgcgcccgccaatggccctgcagct
gcgcaggaaggttcgacgcgtagaccaatgaatcctcctgatagaccgccgcctgttccg
cctcgtccagtacctgatagcgtgaagaaggaactagagattggcgcacagcaggatgtc
acagaagtgatcaataatgtactgttccaagcacagtgtgccgttaagcccgaaggctat
gatgcagacggcgggcaactcgatattgtcactgaactcttctatggcaaaacaaagtca
tacatcacaacgtcggacggtgttcgatgcaaagaagagccatggtcagatattaaagtg
gacgttgcaagacaatccagtgatatatattcagcccttgatggtgcctttgacatgcaa
cgagtgcacatcggtggcgtggaagcggagcaacacggcaccatcagcaaggctcccccg
attctccagattcaaatccagcgagtgcaatttgaccaggttcagatgcagtcgttcaaa
tcaaacaatcacctggagttgagagagacgatatatcttgatcgatatatggacacgcca
ctggatgataaaatccacaggaagcgtcaggagaaatggcgtttaaaggacgagctacag
agattagaaaaacgcagggatgagctctacaacaaggccaaccagcctttacccgaagta
ttcgacatgcttggaaacaaattacaagtgtttatggacctccaagaaagctccaaaatt
aatgatgatggccttggtgtcgaagaatcaacaatagctcttgtttctaggttcgaggag
gctactgaagatgaaatattgtggatcgacaaacggatcgccgagctcggttggcacctc
gagaatacgtttgctgaagacgaaagggtcccgtaccgtctgtatgcggtatttattcat
cgaggctcggcctcagctggtcattattggatttatatttttgatttcgagaaaaaaatc
tggcgtgaatataacgacgagcaggtattggaaattaagaagctgtcaacaatattcgcg
ccagagacaggacctcactcgccgtcgccttacttcctagtatacgtcaatgatcctctg
aaggaaaaactcaccaatccagtatgccgggccgttagagacctaccttcaccggacttg
cctacaaatacggtcgatccgccgccgttcaagacctcagaggagcagatggataggcat
gccaggccgcccactagagaacctgtcaaggggaagcagcagcccgccgatggagtggca
caacaagatctcgaaatgtccgacgccccaccatcatacgaagacgtgacttctatgaac
aataaaggggtaaatgtttcggcccgagaaatttcaccgtcgccatctccatctccgcca
tcgaaccctctaaaacgtaaacactga

DBGET integrated database retrieval system