KEGG   Coccidioides immitis: CIMG_01822Help
Entry
CIMG_01822        CDS       T01114                                 

Definition
(RefSeq) TORC1 growth control complex subunit Kog1
  KO
K07204  
regulatory associated protein of mTOR
Organism
cim  Coccidioides immitis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 1421 aa AA seqDB search
MRDPKLDMYMNAKPQSQTVEQMQGQAQNKSVRVSFEPQVESYDSLTPELRPPALSHHRSQ
TVNFEGNGHIDVSNSVSGTATPASGQASARIAEPVMRSARPTSTLVRAKSDHWLKSDGEN
DAKKDDDEDFELRHGWQEEYTSSEYLKILNSNFYMYFNEKRHDTGGIPKEQTGSWLQQDW
RMRDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSSGGAQNKVMEQIGKKLQ
EQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLPTPSGEIWVF
NKTYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGHIVSNFHKFVEKHEKENVEARRKDANA
PIQNYSDCILLAACDKTESLPTNPDLPADLFTCCLTTPIQIALRYFMLQNPLQCGVPPDE
IKVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAALFRNFLLSER
IMRTHECRPISSPELPETHTHPLWQSWDLAVEMVLSQLPALLEHEEGKRHYEYQHSSFFS
EQLTAFEVYLSSGPTESNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGPWAVHLALSI
GIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFITILNPSIGIPV
GNVSEHRAMCAFIISIFCKEYPQGQNVCLSPELIEFCLHHLMDVENPLLRQWCCLCISML
WNNFAEAKWMGIRCSAPARLCELTMDPVPEVRAAMLHALTSFIGIPDLTDQVAQVEEYLA
TAIVPMGNDGSALVRRELLVFLSTFVKRYQNKFLVTAYEQLLEEKHLLKHSVSGSKDTQP
PPFRDHGVSHNTIYGSLWKLLLILSVDPQEEVAQDAGVVVDYVYKILFDSPVGSLAQDVR
DEVLALHRRSRSKKPQPSESVEVKKIRPETPPVQIPSKQEGYLSLSLRRTASVAASLKNL
AFGSAATIDQRPSSPLNPSGRQTMAKNRMTITPRGRAPPEWTRPPEVNDQPVSAGQYGQA
PTPPSRGVNPRDLTKEPSIPLKSNFLEWSTEYFREPQMKPNEPDEPGSADYNQRLWRRAR
NERIIVETQQLKDKGGSGRWDVALTLMSNPSQPAKMCFHQFEDHLAVADDRDTICIWDWE
SNSRLSRFSNGNPLGSRINEVRFINEDDQALLMTGSSDGVLKIFRNYESDRRIELITAFR
ALPELIPSNKNAGLVLDWQQGQGKALIAGDVKVIRVWNAATEVCTNDISARSGSCITSLT
SDQVAGNIFIAGFGDGAVRVFDQRLKPTTAMVKVWREHKQWITNVHMQRGGVRELISGSR
NGEVRLWDLRMDNSIDTIQATKDTLRTLSVHEHAPVFSIGTNRHEVKTFNVDGSYLSSFE
PHGSFLSQSRTSPVVGAAFHPHKMVMACSALYDNYVNLVSC
NT seq 4266 nt NT seq  +upstreamnt  +downstreamnt
atgagggacccaaagctagacatgtacatgaatgcgaaacctcaatcacagacagtcgaa
caaatgcagggccaagcgcagaacaaatctgtgcgcgtcagtttcgagccacaggtcgaa
agttacgattctctgactccggaattacgccctccggcactgagccatcatagatctcag
acggtgaactttgaagggaatggccacatcgatgtctctaattcggtctctgggacagcg
actcccgcgtcgggacaagcgtccgcacgaatagctgagccagtaatgaggagcgcgagg
ccaacctctactcttgttcgagcgaaaagcgatcactggcttaagagcgatggagaaaac
gatgcgaagaaagacgatgatgaagattttgagctaaggcacggctggcaagaggaatat
acttctagtgaatacttgaagatattaaattcgaatttctatatgtatttcaatgagaaa
cgccacgataccgggggaatccccaaggaacaaacggggagctggttacaacaggactgg
cgcatgagggatcggctaaagacagtatccgctgcgctcgctatttgccttaatattggc
gttgaccctccagatgttgttaagacgaatcccagcgcgaagctagagtgttgggtagat
ccaacctcatccggtggcgcacagaataaagtgatggaacagattggcaagaaactacag
gagcagtacgagactctaagcctccgaacccggtataagcagtatctagacccatcagtg
gacgaaacaaagaaattctgcatatcccttcgacggaatgcgaaagatgagagggtatta
tttcactacaatggccatggcgttcctctcccaactccatccggtgagatttgggtgttc
aacaaaacttatacacagtatatcccggtatcattatacgatcttcaatcctggcttgca
ggtcccagcctatttgtctttgacgtctcccatgcgggtcacattgtctcgaatttccat
aaatttgtggaaaagcatgaaaaggagaatgttgaagctcgcaggaaagatgcaaatgct
cccattcagaactacagtgattgcatccttcttgctgcctgcgataaaactgaatccttg
ccaactaaccctgaccttcctgccgatctgtttacctgttgtttgacaacccctattcag
atcgctcttagatacttcatgcttcagaatcccttgcaatgtggcgtcccgccggacgaa
attaaagttcccggacgcctgcaagaccgacgaagtccgctcggagaacttaattggatc
tttacagcaatcactgacaccattgcttggaacacccttcctcgtgctcttttcaagaag
ctttttcgtcaagacctcatggttgcagctttattccgaaattttcttcttagcgaaagg
attatgaggacccatgaatgtcgcccgatctcctcacccgaactccctgaaacacatact
catcccttatggcagagttgggatcttgccgttgagatggtcctttcccagctacccgca
cttcttgaacacgaggagggaaagcggcattacgagtaccagcactcaagtttcttttct
gaacaactcacagcctttgaagtttacctctcatctggacctacggaaagtaacccacca
gatcagctaccaattgtcttacaggtgttattaagccaggcgcatcggctacgcgcgctg
atcctcctgagcaaatttcttgacctcggtccctgggcggttcatcttgcactgagcata
ggaatatttccgtacgtggtgaaattattacagagtgccgcgcaggaacttaaacccgtc
atggtgttcatatgggcgcggatcatggccgtggaccatacggttcagaacgacttgctt
aaggataatggcatccattactttataactattcttaatccctctatcggtatcccggtg
ggtaatgtgagtgagcatcgggcgatgtgcgcctttattatcagcatcttttgcaaggaa
taccctcagggccaaaacgtgtgtctttcgccagaattgatcgaattctgtcttcatcac
ctgatggatgtcgagaatccgctgttgcgacaatggtgctgcctttgtataagcatgttg
tggaataattttgcagaggcaaagtggatgggaatccgatgctccgcgccagcacggctt
tgcgagctcactatggaccccgtcccagaggtccgagcagcaatgcttcatgctctaacg
agcttcattggtatccctgatttgacagaccaagttgcacaggttgaagagtaccttgca
acagcgattgttccgatggggaatgatggaagcgccttagtacgaagagaacttctggtc
ttcttatccacttttgtgaaaagatatcagaacaagttcctggtgactgcttatgagcaa
cttttggaagaaaagcatcttctcaaacactctgtttcaggctccaaggatactcagcca
ccaccattccgcgaccatggtgtttctcacaatacaatatatggatccctctggaaatta
ctacttatcctctcagtcgacccacaggaagaggtagctcaggacgccggagtagttgtc
gactatgtctacaaaattcttttcgattcaccagtgggaagcttagctcaggatgttcgt
gatgaagtccttgctctacatagacgttcgcgatctaagaaaccacagccttccgaatca
gttgaggtgaagaaaataagaccggaaacaccgccagtccagatccctagcaagcaggag
ggatatctttcattaagcttaaggaggacagcaagcgtggctgcatccttgaaaaacctt
gcatttgggtcggctgccaccattgatcagcgtccttcatcgcctcttaatccatctggc
aggcaaacaatggctaagaaccgtatgaccattactcctcgcggtcgtgcacctcccgaa
tggacacgaccgcccgaagtgaatgatcaaccagtttccgctggtcaatatggccaagca
cccacaccaccttcaaggggcgttaatcccagagatttaacgaaggaaccatcgatcccg
ctgaagagcaactttttggaatggtcgacagaatacttccgcgagccgcaaatgaaacct
aacgagccggatgaacctggcagcgctgattacaatcaaagactatggcggcgcgcccgg
aatgagaggataattgtcgaaacacaacagctaaaggataaaggcggaagtggccggtgg
gatgtagcattaactcttatgagtaatccaagtcaaccggcaaagatgtgcttccaccag
ttcgaggaccacctcgcggttgctgatgatagagatactatctgcatatgggattgggaa
agcaactcccggctcagtcggttttctaatggcaacccactgggttcaaggatcaatgaa
gttcggtttatcaacgaagacgatcaagctctcttgatgactggctcttctgatggagtt
ttgaaaatattccgcaactacgagtctgatcggaggatagagctgattactgctttccgc
gcgctgcctgaactaatccctagtaataaaaatgccggcctcgtcttagactggcaacag
ggccaggggaaggcacttatcgctggagacgtaaaggtcattcgtgtttggaatgcagcc
actgaagtatgcacgaatgatatatctgctcgttccggctcctgtattacttctttaaca
tcggatcaagttgctggcaacattttcattgccggattcggtgacggcgctgttcgagta
ttcgaccaacgattaaaacccaccaccgcgatggtgaaagtctggcgagagcacaaacaa
tggattacaaacgttcacatgcaacgaggcggagtaagagaacttatatctggtagccgg
aatggtgaagtcagactatgggatctgagaatggataactcaattgacaccattcaagcc
accaaggacacattaagaacgttgagcgtacacgagcatgccccagtgttttctattggt
accaaccggcatgaagtcaaaactttcaatgtcgacggatcgtacctctcttcattcgaa
ccgcacggtagcttcctctcccaaagccgcacttcgcccgtcgtcggcgcggccttccat
ccgcataaaatggtcatggcatgctctgccctctatgataattatgtcaatctcgtttct
tgctga

DBGET integrated database retrieval system