KEGG   Coccidioides immitis: CIMG_01822Help
Entry
CIMG_01822        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cim  Coccidioides immitis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1357 aa AA seqDB search
MRDPKLDMYMNAKPQSQTVEQMQGQAQNKSVRVSFEPQVESYDSLTPELRPPALSHHRSQ
TVNFEGNGHIDVSNSVSGTATPASGQASARIAEPVMRSARPTSTLVRAKSDHWLKSDGEN
DAKKDDDEDFELRHGWQEEYTSSEYLKILNSPPVKLIGFENFYMYFNEKRHDTGGIPKEQ
TGSWLQQDWRMRDRLKTVSAALAICLNIGVDPPDVVKTNPSAKLECWVDPTSSGGAQNKV
MEQIGKKLQEQYETLSLRTRYKQYLDPSVDETKKFCISLRRNAKDERVLFHYNGHGVPLP
TPSGEIWVFNKTYTQYIPVSLYDLQSWLAGPSLFVFDVSHAGHIVSNFHKFVEKHEKENV
EARRKDANAPIQNYSDCILLAACDKTESLPTNPDLPADLFTCCLTTPIQIALRYFMLQNP
LQCGVPPDEIKVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRALFKKLFRQDLMVAAL
FRNFLLSERIMRTHECRPISSPELPETHTHPLWQSWDLAVEMVLSQLPALLEHEEGKRHY
EYQHSSFFSEQLTAFEVYLSSGPTESNPPDQLPIVLQVLLSQAHRLRALILLSKFLDLGP
WAVHLALSIGIFPYVVKLLQSAAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFITI
LNPSIGIPVGNVSEHRAMCAFIISIFCKEYPQGQNVCLSPELIEFCLHHLMDVENPLLRQ
WCCLCISMLWNNFAEAKWMGIRCSAPARLCELTMDPVPEVRAAMLHALTSFIGIPDLTDQ
VAQVEEYLATAIVPMGNDGSALVRRELLVFLSTFVKRYQNKFLVTAYEQLLEEKHLLKHS
VSGSKDTQPPPFRDHGVSHNTIYGSLWKLLLILSVDPQEEVAQDAGVVVDYVYKILFDSP
VGSLAQDVRDEVLALHRRSRSKKPQPSESVEVKKIRPETPPVQIPSKQEGYLSLSLRRTA
SVAASLKNLAFGSAATIDQRPSSPLNPSGRQTMAKNRMTITPRGRAPPEWTRPPEVNDQP
VSAGQYGQAPTPPSRGVNPRDLTKEPSIPLKSNFLEWSTEYFREPQMKPNEPDEPGSADY
NQRLWRRARNERIIVETQQLKDKGGSGRWDVALTLMSNPSQPAKMCFHQFEDHLAVADDR
DTICNKNAGLVLDWQQGQGKALIAGDVKVIRVWNAATEVCTNDISARSGSCITSLTSDQV
AGNIFIAGFGDGAVRVFDQRLKPTTAMVKVWREHKQWITNVHMQRGGVRELISGSRNGEV
RLWDLRMDNSIDTIQATKDTLRTLSVHEHAPVFSIGTNRHEVKTFNVDGSYLSSFEPHGS
FLSQSRTSPVVGAAFHPHKMVMACSALYDNYVNLVSC
NT seq 4074 nt NT seq  +upstreamnt  +downstreamnt
atgagggacccaaagctagacatgtacatgaatgcgaaacctcaatcacagacagtcgaa
caaatgcagggccaagcgcagaacaaatctgtgcgcgtcagtttcgagccacaggtcgaa
agttacgattctctgactccggaattacgccctccggcactgagccatcatagatctcag
acggtgaactttgaagggaatggccacatcgatgtctctaattcggtctctgggacagcg
actcccgcgtcgggacaagcgtccgcacgaatagctgagccagtaatgaggagcgcgagg
ccaacctctactcttgttcgagcgaaaagcgatcactggcttaagagcgatggagaaaac
gatgcgaagaaagacgatgatgaagattttgagctaaggcacggctggcaagaggaatat
acttctagtgaatacttgaagatattaaattcgcctcccgtgaaacttattggtttcgag
aatttctatatgtatttcaatgagaaacgccacgataccgggggaatccccaaggaacaa
acggggagctggttacaacaggactggcgcatgagggatcggctaaagacagtatccgct
gcgctcgctatttgccttaatattggcgttgaccctccagatgttgttaagacgaatccc
agcgcgaagctagagtgttgggtagatccaacctcatccggtggcgcacagaataaagtg
atggaacagattggcaagaaactacaggagcagtacgagactctaagcctccgaacccgg
tataagcagtatctagacccatcagtggacgaaacaaagaaattctgcatatcccttcga
cggaatgcgaaagatgagagggtattatttcactacaatggccatggcgttcctctccca
actccatccggtgagatttgggtgttcaacaaaacttatacacagtatatcccggtatca
ttatacgatcttcaatcctggcttgcaggtcccagcctatttgtctttgacgtctcccat
gcgggtcacattgtctcgaatttccataaatttgtggaaaagcatgaaaaggagaatgtt
gaagctcgcaggaaagatgcaaatgctcccattcagaactacagtgattgcatccttctt
gctgcctgcgataaaactgaatccttgccaactaaccctgaccttcctgccgatctgttt
acctgttgtttgacaacccctattcagatcgctcttagatacttcatgcttcagaatccc
ttgcaatgtggcgtcccgccggacgaaattaaagttcccggacgcctgcaagaccgacga
agtccgctcggagaacttaattggatctttacagcaatcactgacaccattgcttggaac
acccttcctcgtgctcttttcaagaagctttttcgtcaagacctcatggttgcagcttta
ttccgaaattttcttcttagcgaaaggattatgaggacccatgaatgtcgcccgatctcc
tcacccgaactccctgaaacacatactcatcccttatggcagagttgggatcttgccgtt
gagatggtcctttcccagctacccgcacttcttgaacacgaggagggaaagcggcattac
gagtaccagcactcaagtttcttttctgaacaactcacagcctttgaagtttacctctca
tctggacctacggaaagtaacccaccagatcagctaccaattgtcttacaggtgttatta
agccaggcgcatcggctacgcgcgctgatcctcctgagcaaatttcttgacctcggtccc
tgggcggttcatcttgcactgagcataggaatatttccgtacgtggtgaaattattacag
agtgccgcgcaggaacttaaacccgtcatggtgttcatatgggcgcggatcatggccgtg
gaccatacggttcagaacgacttgcttaaggataatggcatccattactttataactatt
cttaatccctctatcggtatcccggtgggtaatgtgagtgagcatcgggcgatgtgcgcc
tttattatcagcatcttttgcaaggaataccctcagggccaaaacgtgtgtctttcgcca
gaattgatcgaattctgtcttcatcacctgatggatgtcgagaatccgctgttgcgacaa
tggtgctgcctttgtataagcatgttgtggaataattttgcagaggcaaagtggatggga
atccgatgctccgcgccagcacggctttgcgagctcactatggaccccgtcccagaggtc
cgagcagcaatgcttcatgctctaacgagcttcattggtatccctgatttgacagaccaa
gttgcacaggttgaagagtaccttgcaacagcgattgttccgatggggaatgatggaagc
gccttagtacgaagagaacttctggtcttcttatccacttttgtgaaaagatatcagaac
aagttcctggtgactgcttatgagcaacttttggaagaaaagcatcttctcaaacactct
gtttcaggctccaaggatactcagccaccaccattccgcgaccatggtgtttctcacaat
acaatatatggatccctctggaaattactacttatcctctcagtcgacccacaggaagag
gtagctcaggacgccggagtagttgtcgactatgtctacaaaattcttttcgattcacca
gtgggaagcttagctcaggatgttcgtgatgaagtccttgctctacatagacgttcgcga
tctaagaaaccacagccttccgaatcagttgaggtgaagaaaataagaccggaaacaccg
ccagtccagatccctagcaagcaggagggatatctttcattaagcttaaggaggacagca
agcgtggctgcatccttgaaaaaccttgcatttgggtcggctgccaccattgatcagcgt
ccttcatcgcctcttaatccatctggcaggcaaacaatggctaagaaccgtatgaccatt
actcctcgcggtcgtgcacctcccgaatggacacgaccgcccgaagtgaatgatcaacca
gtttccgctggtcaatatggccaagcacccacaccaccttcaaggggcgttaatcccaga
gatttaacgaaggaaccatcgatcccgctgaagagcaactttttggaatggtcgacagaa
tacttccgcgagccgcaaatgaaacctaacgagccggatgaacctggcagcgctgattac
aatcaaagactatggcggcgcgcccggaatgagaggataattgtcgaaacacaacagcta
aaggataaaggcggaagtggccggtgggatgtagcattaactcttatgagtaatccaagt
caaccggcaaagatgtgcttccaccagttcgaggaccacctcgcggttgctgatgataga
gatactatctgtaataaaaatgccggcctcgtcttagactggcaacagggccaggggaag
gcacttatcgctggagacgtaaaggtcattcgtgtttggaatgcagccactgaagtatgc
acgaatgatatatctgctcgttccggctcctgtattacttctttaacatcggatcaagtt
gctggcaacattttcattgccggattcggtgacggcgctgttcgagtattcgaccaacga
ttaaaacccaccaccgcgatggtgaaagtctggcgagagcacaaacaatggattacaaac
gttcacatgcaacgaggcggagtaagagaacttatatctggtagccggaatggtgaagtc
agactatgggatctgagaatggataactcaattgacaccattcaagccaccaaggacaca
ttaagaacgttgagcgtacacgagcatgccccagtgttttctattggtaccaaccggcat
gaagtcaaaactttcaatgtcgacggatcgtacctctcttcattcgaaccgcacggtagc
ttcctctcccaaagccgcacttcgcccgtcgtcggcgcggccttccatccgcataaaatg
gtcatggcatgctctgccctctatgataattatgtcaatctcgtttcttgctga

DBGET integrated database retrieval system