KEGG   Coccidioides immitis: CIMG_01981Help
Entry
CIMG_01981        CDS       T01114                                 

Definition
(RefSeq) CMGC/MAPK protein kinase
Organism
cim  Coccidioides immitis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 422 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYNVTKEVGQGAYGIVCAASNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDHFNEVYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPDE
NAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLRRIGSPRAQDYVRNLPYMQKVPFQRLFPNANPEALDLLDRMLAFDPS
SRISVEEALEHPYLQIWHDASDEPTCKTTFDFHFEVVEDVHDMRKMILDEVMRFRAHVRQ
PHIQMGNAGQQAAAQQTSVPIPEENIASWKQDEPRPQEAIHGGMQPNDLEASLQGGMDAM
RS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttacaaggacgtaaggtgttcaaggtgtttaaccaggatttcatcgtcgac
gaacggtacaatgtcacaaaggaggtcgggcaaggtgcttatggaattgtttgtgccgca
tccaacgtacagaccggcgagggcgttgctatcaaaaaggtcaccaatgtcttcagcaag
aaaatcttggctaagagagccctgcgagaaattaaactgttgcaacatttccgcggtcat
cgcaatatcacctgcctctacgacatggacattccaagaccagaccacttcaacgaggtc
tatctctatgaagaacttatggaatgtgatctggctgccatcatccgttccggccagccc
ctgaccgatgctcacttccaatctttcatctatcagattctttgtggactgaaatacatt
cactccgccaacgtcttacaccgtgatttaaaaccaggaaacctcttggtcaacgctgac
tgcgagctcaagatctgcgattttggtcttgctcgtggtttctcaattgatccagatgaa
aacgctggatacatgactgaatatgttgcgacgagatggtaccgtgctccagagatcatg
ttgagcttcccgagctacacgaaagctattgacgtgtggtctgtcggttgcattcttgca
gaattacttggcggaagaccgtttttcaaaggtcgtgattacgttgaccaactgaatcag
atccttcattatttggggactccaaatgaagagacccttcgccgcattggctccccacgt
gcacaggattatgtccgcaatttaccatacatgcagaaagttccttttcaacgattgttc
ccgaatgcgaacccagaagctttggacctacttgatcggatgttggcgttcgatccctca
tcccgtatctcggtcgaagaagctcttgaacacccttatttacagatttggcatgacgca
tccgacgagccgacttgcaaaactacatttgacttccactttgaagttgtcgaagacgtt
catgatatgcgcaagatgattttagacgaggttatgcgattccgtgcacatgtgcgacaa
ccacatattcaaatgggcaatgcgggacaacaggctgcagcgcagcagaccagtgtccct
atacccgaagaaaacatagcatcttggaaacaagacgaaccacggcctcaggaggccatt
catggggggatgcagcctaatgatcttgaagcctcgttacaaggaggtatggatgctatg
cgatcataa

DBGET integrated database retrieval system