KEGG   Coccidioides immitis: CIMG_01981Help
Entry
CIMG_01981        CDS       T01114                                 

Definition
similar to MAP protein kinase MPKA
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cim  Coccidioides immitis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cim00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CIMG_01981
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CIMG_01981
Protein kinases [BR:cim01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CIMG_01981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 421 aa AA seqDB search
MADLQGRKVFKVFNQDFIVDERYNVTKEVGQGAYGIVCAASNVQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDHFNEVYLYEELMECDLAAIIRSGQP
LTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPDE
NAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQ
ILHYLGTPNEETLRRIGSPRAQDYVRNLPYMQKVPFQRLFPNANPEALDLLDRMLAFDPS
SRISVEEALEHPYLQIWHDASDEPTCKTTFDFHFEVVEDVHDMRKMILDEVMRFRAHVRQ
PHIQMGNAGQQAAAQQTSVPIPEENIASWKQDEPRPQEAIHGGMQPNDLEASLQGGMDAM
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcagatttacaaggacgtaaggtgttcaaggtgtttaaccaggatttcatcgtcgac
gaacggtacaatgtcacaaaggaggtcgggcaaggtgcttatggaattgtttgtgccgca
tccaacgtacagaccggcgagggcgttgctatcaaaaaggtcaccaatgtcttcagcaag
aaaatcttggctaagagagccctgcgagaaattaaactgttgcaacatttccgcggtcat
cgcaatatcacctgcctctacgacatggacattccaagaccagaccacttcaacgaggtc
tatctctatgaagaacttatggaatgtgatctggctgccatcatccgttccggccagccc
ctgaccgatgctcacttccaatctttcatctatcagattctttgtggactgaaatacatt
cactccgccaacgtcttacaccgtgatttaaaaccaggaaacctcttggtcaacgctgac
tgcgagctcaagatctgcgattttggtcttgctcgtggtttctcaattgatccagatgaa
aacgctggatacatgactgaatatgttgcgacgagatggtaccgtgctccagagatcatg
ttgagcttcccgagctacacgaaagctattgacgtgtggtctgtcggttgcattcttgca
gaattacttggcggaagaccgtttttcaaaggtcgtgattacgttgaccaactgaatcag
atccttcattatttggggactccaaatgaagagacccttcgccgcattggctccccacgt
gcacaggattatgtccgcaatttaccatacatgcagaaagttccttttcaacgattgttc
ccgaatgcgaacccagaagctttggacctacttgatcggatgttggcgttcgatccctca
tcccgtatctcggtcgaagaagctcttgaacacccttatttacagatttggcatgacgca
tccgacgagccgacttgcaaaactacatttgacttccactttgaagttgtcgaagacgtt
catgatatgcgcaagatgattttagacgaggttatgcgattccgtgcacatgtgcgacaa
ccacatattcaaatgggcaatgcgggacaacaggctgcagcgcagcagaccagtgtccct
atacccgaagaaaacatagcatcttggaaacaagacgaaccacggcctcaggaggccatt
catggggggatgcagcctaatgatcttgaagcctcgttacaaggaggtatggatgctatg
cggtaa

DBGET integrated database retrieval system