KEGG   Coccidioides immitis: CIMG_02130Help
Entry
CIMG_02130        CDS       T01114                                 

Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase, E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cim  Coccidioides immitis
Pathway
cim00020  Citrate cycle (TCA cycle)
cim00310  Lysine degradation
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01130  Biosynthesis of antibiotics
cim01200  Carbon metabolism
Module
cim_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cim_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CIMG_02130
  Amino acid metabolism
   00310 Lysine degradation
    CIMG_02130
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CIMG_02130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_3 Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 4568205
NCBI-ProteinID: XP_001248359
UniProt: J3KKQ7
AA seq 484 aa AA seqDB search
MKGYTSMLRSMSPRLQFSPAISRTSNQLLRQRTCQQQSRQIRLLSYSRVYSNSGKASHLS
QSGLWRSSQCLRRNILRPIPSQLNSCQLRFYADTIVKVPQMAESISDGTLKQFSKQIGDF
VERDEELATIETDKIDVTVNAPESGIIKEFLAKEEDTVTVGQDLVKLQPSTENPSSGKDK
LQENTQSAELKVREEQPQEQPNRRERGESAQVTQQQPSPKEEKPAPKVERESPKESQLMA
NAAHGSVGNRDERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKEDI
LKKTGIKLGFMSAFARACVLAMKEVPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLV
TPVVRNVENMDLTTIEKAIADLGQKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINL
PQTGVLGLHAIKNRPVAVNGKVEIRPMMYLALTYDHRLLDGREAVTFLVRVKEFIEDPRR
MLLG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttacacatcaatgttaagaagcatgtctcctcgccttcaattcagtcctgcg
atctcgcgcacctcaaatcaattgctcagacaaaggacctgtcagcaacagtcgcgtcaa
attcggttactctcatactcaagggtatattcaaacagcggcaaagcttcacatctctcc
caatccggactttggcgttcctcgcaatgcttaaggcgaaatattttgcgaccaattcca
tcgcaattaaatagttgccagctacgcttctacgctgataccatcgttaaagtccctcag
atggcggaatcaatttcagatgggaccctgaaacaattttcaaagcagatcggggacttc
gtagagcgggatgaagagctcgccacgatcgaaactgacaagatcgatgttaccgtgaat
gcaccggaatccgggataatcaaagaatttctagcaaaggaagaagacaccgtaactgtt
ggtcaagacctcgtcaaactacaaccgtcgacagaaaatccgagctccggaaaggacaaa
cttcaggaaaacacgcaatccgcggagctcaaagtgcgagaggaacaacctcaggagcaa
ccgaacagaagagagaggggagagtcggcccaggttacccagcaacagcccagtccaaag
gaggagaagcccgctcctaaagtagaacgagagtctccaaaagaatcccagctaatggct
aatgccgcccatgggagcgttggcaacagagacgagcgcagagtaaaaatgaaccgcatg
cgactacgaattgccgagcgtctcaagcaatcccaaaacactgcagcatctctaacaacc
ttcaacgaagttgatatgtcatcgcttatggaattccgcaagttatataaagaggacatc
ctgaagaaaaccggtatcaagcttggattcatgagtgcgttcgcgcgcgcgtgtgtattg
gccatgaaggaagtaccggctgtgaatgcctccattgagggaccaaatgggggagacaca
attgtataccgagactatgttgacattagcgttgcggttgcaactgagaaaggcctggta
acccccgttgtgcgaaatgtcgaaaacatggaccttactacgatcgagaaggccatcgct
gatctagggcagaaggctcgagacaataaattgaccatcgaggacatggctggcggcacc
ttcactattagcaatggaggtgtttttggctcattaatgggcactcctatcatcaatctt
ccgcaaacaggagttcttggtcttcacgcaataaagaataggcctgtggcagtcaatggg
aaagttgaaatcagacctatgatgtatcttgccttgacttatgatcaccgcctcctcgac
ggcagagaagctgtcacatttttagttcgagtcaaggagttcattgaagatccaaggcgc
atgttactggggtaa

DBGET integrated database retrieval system