KEGG   Coccidioides immitis: CIMG_02133Help
Entry
CIMG_02133        CDS       T01114                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
cim  Coccidioides immitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 139 aa AA seqDB search
MAPKAAEKKPSTGGKAPAGGKAPAEKKEAGKKTAASGEKKKRTKARKETYSSYIYKVLKQ
VHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELA
KHAVSEGTKAVTKYSSSAK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaaagctgctgaaaagaagccaagcactggcggaaaggctcccgccggcggt
aaagcacccgctgaaaaaaaggaagctggcaagaaaacggctgcttcaggcgagaagaaa
aagcgaactaaggctcggaaggaaacgtattcttcatatatttacaaagtcctcaaacaa
gtccatccggacactggtatctctaaccgcgcaatgtctatcctaaattcttttgtgaat
gatatctttgaacgcgtcgccactgaagcatcaaaacttgctgcatataacaagaagtcc
acgatttcttcacgggaaatccaaacctctgtgcgcctaattctaccaggagaactcgcc
aagcatgctgtttctgaaggcaccaaagctgtcacaaaatattcttcttctgccaaatag

DBGET integrated database retrieval system