KEGG   Coccidioides immitis: CIMG_02137Help
Entry
CIMG_02137        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
cim  Coccidioides immitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 435 aa AA seqDB search
MTKRKRLTREAKWLVDHPLVCNRQDNCYMGRLGSNPPQPATQLTTQQSHKSIMQPHHHSF
IAQGTPYRVFIYRHKLYSVVLQMQQTCKYSIQDTCFSPVVAKLTTLFVLKSFVIMADCPK
HHCLYSRESRTPNYTIFGGPISSSGQLHKPLWHGFCEIESEPALFNVMLRDWGVKGVKVQ
EVVSLDNDMLQFLQPIYGLVFLFRWREDDPVKQEQSCPEGLWFANQTVNYACASVALLNI
INNIEGVELDEELRSFKEFTMDFTPALRGDAIRNFAFIKEIHNSFARKMDILNVDLQLKN
DASKKRSKLCRKDQGFDESEAGFHFIAFVPARGKVWKFDGLERQPQNLEKAVVSEIDMQS
YTNMSKERLLEAQKTLIDAQKEICVAIKEEQQVREADNTYAEKKRHDYGPAVYSWLRALA
RKGLIEHLARDTPPP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactaagagaaaaagacttacaagagaagcaaaatggttggttgatcatccactagta
tgcaaccgccaagataactgttacatggggcgcctgggtagtaacccgccgcaacctgcc
acccagctaactacccagcagagtcacaagtcaataatgcaaccgcaccatcattccttc
atagctcaaggtactccgtacagagtatttatatacaggcataagctgtactctgttgta
ctgcaaatgcagcaaacatgcaagtacagtatccaggacacctgtttttctcctgtggtt
gccaaattaaccactttgttcgttttgaagagctttgtcataatggcagactgcccaaaa
catcattgcctttactctagagaatctagaaccccaaattacactatatttggtggccct
atttcatcatccgggcagcttcacaagcccttgtggcatggattttgcgagattgaatcc
gaaccagcccttttcaatgttatgctaagggactggggtgtgaaaggtgtcaaagtccag
gaagttgtctctcttgacaatgatatgctgcaatttttacaacccatctatggactagta
tttttgttccgttggcgagaggatgatccagtaaaacaagaacaaagttgtcctgaaggt
ctgtggtttgcaaatcagacagtgaattatgcctgtgctagtgttgcactgctcaatatt
atcaataatattgaaggagtagaacttgatgaggagctccgttccttcaaagaattcaca
atggatttcactccagcgctgcgcggtgatgctataaggaattttgcattcattaaggaa
atacacaactcgtttgcaaggaaaatggacattctaaatgttgacctccaactcaaaaat
gatgcgtctaagaaaagatccaagctttgcagaaaggaccaaggctttgatgaatcagag
gcagggttccatttcattgcctttgtacccgcaagggggaaggtatggaaattcgatgga
ttagagcgccaacctcaaaatcttgaaaaggcggttgtgtccgaaatcgatatgcaaagc
tataccaacatgtcgaaggagcgtctgctagaagctcagaaaacacttatcgatgcccag
aaggaaatatgtgtggcgattaaagaagaacagcaagtacgcgaggcggataatacttat
gcagaaaaaaagcggcatgattacggcccggcagtctacagctggcttcgtgcgttagct
cgaaaggggctaattgaacatttggcgagagatacgccaccgccttga

DBGET integrated database retrieval system