KEGG   Coccidioides immitis: CIMG_02466Help
Entry
CIMG_02466        CDS       T01114                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CIMG_02466
Peptidases [BR:cim01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CIMG_02466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 892 aa AA seqDB search
MMNHHLPPLPHGQPPLPPPRRQHDIPYASAPPNVRSSQAYMGYHHPHPHATGPLPPYAPH
QYQQHWYPYQQMPHPPPPQPYQSYSPLIVSSYPRSQHIAATGPPPSFPLQTPTTASTPQL
SSFSSTPPPIVAPSSATSDLQEDVSTNRPAEAQSKAIDGGSTSSGTALVPSAVVPEASVN
ERTSIEPTAREPFQPPLPWLSVPEAPFPEKLPRRRRKPRIAEVTKQSVSLSFKADSEGNE
PQKPGLEAEPPLPERTATPTPTASHAPSEPTSTQPTTPSSSSNSQSPSHVRQVSQATTPR
MAAPIVPIVPVVPIMPATPHLSKQGQQTTGSATDNTKPIESVQPSQSTADQQDLKATPPP
RSQPKSWADLVRTKKPTSGSDDAVSTSGVGGLAPSKSESLVDVINSLASEADLYSNKIAF
VEPRGLVNTGNMCYMNSVLQVLVFCVPFYDFLDRVSRRAAHSFKSELPLLDAMIMFMREF
RVIGSASSVEQLRQRLKQTELEQYGSSFIPEYVYQVIRHLPRFRDMRRGHQQDAQEFLGF
LFEELHEECLHAIKSSSALPEAASASDVDAVSMTDDSAGEGWLEVGHKQKAAVTRSSGHI
ASESPITRIFGGNLRSEFRVPGNKNSVTLEPYQSLQLDIGSPQVNNIIDALKGLTRPETM
HGDFSSSRGTKVNATKQVFIESLPPVLILHLKRFHYDSVTKGTQKIWKKIGYPLELEIPK
EVFAPHRRNMLAAQGGGLPKYRLTGVIYHHGKNASGGHYTVEIRRQDGREWIRIDDTVIR
RVRSEDVAFAGSEEDPKSQAAALEQHKSLDSSSQSNIFRHFDQDDEQDSERGWNQVNGSG
SSHASKKSVSALANGTSPPNTASGDSSGKRTSSSRLAARENKVAYLLFYQRI
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccatcatctgcccccgctgcctcacgggcagccgcccctacctcctcctcgc
cgacagcacgatattccctatgcgtcggcgccgcctaatgtgcgctcgtcccaagcatac
atgggctatcaccacccccatcctcacgcgaccggtcctctacccccatacgcaccccat
caataccagcagcactggtatccatatcaacagatgccacaccctccaccaccgcaaccg
taccagtcgtacagtcctttgatcgtctcctcgtaccctcgttcccagcatatcgccgca
accggcccaccaccttcattccccttgcagacccctactaccgcctcaacgccgcagctt
tcgtccttctcctcgacgcctcccccaatcgttgccccgtcatctgccacttcggattta
caggaagatgtatccacaaaccgcccggcggaggcccaatccaaagcaattgatggaggt
tcgacaagctcgggcactgcgttggttcctagtgcagttgttccggaagcctcggtcaat
gagcgcacaagcatagaacccaccgccagagaaccgtttcagccaccgctgccctggttg
tcggttcctgaggccccattccctgagaagctacctcggagacggcgaaagcccaggatc
gctgaagttaccaagcaatctgtgtctctctccttcaaggccgacagcgagggaaatgaa
ccccagaaacccggtcttgaagcagaacccccattgcccgagcgtactgccactcccact
ccaacagcctcccacgccccatctgaacccacctcgacacagccaaccactccttcgtct
tccagcaactcacaatctccgtcccatgttcgccaagtgtctcaggcaaccacgccacga
atggcagccccaatcgttccgatcgttcctgttgttcccatcatgccagctacaccccac
ctttcgaagcaaggacagcagaccaccggaagtgccacagacaacactaaacccattgag
tcagtgcagcccagccaaagtactgctgaccagcaggacttgaaagcaacgcctccacct
cgttcgcagccaaaatcatgggccgaccttgttcggacgaaaaagccaacctcgggaagt
gatgacgccgtgtcaacatcgggtgttggcggtttggctccgtccaagtctgaatctctc
gtcgacgttattaatagcttggcttcagaagcggatctttatagcaataagattgccttt
gttgagcctcgaggtcttgtaaatacgggtaatatgtgttatatgaactcggtcctccaa
gttctcgtcttttgtgttccattttatgatttccttgatcgggttagtcgtcgtgctgca
cacagcttcaagagcgagctcccgcttctcgacgcaatgattatgtttatgagagaattt
cgagtaattggctcggcaagttctgtcgagcagttgcggcaacgtttgaagcagactgaa
ctagagcaatatgggtcatcattcattccagaatacgtttaccaggtcatcagacatctc
cctcgctttagagatatgcgccgaggccatcaacaagatgcccaagaattcctcggtttc
ttgtttgaagagcttcacgaagagtgcttacatgcaataaagagctcttccgctttgcct
gaagctgcaagtgcttcagatgtcgatgctgtctccatgacagatgattccgctggtgaa
ggttggttagaagttggccataagcagaaagccgccgtcacccgatcatcgggacacatt
gcttcagaatccccaatcacgagaatcttcggtggcaaccttcgctctgaattcagagtc
cccggaaataaaaactccgttaccttggagccttaccagtcgcttcaacttgatattggc
tctcctcaagttaataatatcatcgatgcactaaagggccttaccagaccggaaactatg
cacggggattttagctcctcgcgtggtaccaaagtgaatgccaccaagcaggtgttcatt
gaaagcctaccaccggtcctgattctccatctgaagcgcttccactatgatagtgtaaca
aagggcactcagaaaatttggaagaagattggatatcctttggaactcgaaatccccaag
gaggtgttcgctccacaccgtcgaaatatgttagctgcccagggtggtggccttcccaag
tataggcttaccggtgttatttatcaccatggcaaaaatgcaagcggcggccactatacg
gtggaaatccgccgtcaagatggccgcgaatggatccgtatcgatgataccgtgattcgc
cgcgttcgaagcgaggatgttgcatttgcaggaagtgaggaagatccaaagagccaggct
gctgccctcgagcagcataaatctctcgatagcagctcacagtcgaatatcttccgccat
ttcgaccaggacgacgagcaagacagcgagcgtggatggaaccaggtcaacggctcgggg
tcgagccacgcaagcaaaaaatcagtcagcgcgctggccaacggaaccagcccacccaac
accgcgtcaggagactcctcgggcaagaggacttccagcagccgattggcagctcgggag
aacaaggtcgcctatctgcttttctatcagcggatctaa

DBGET integrated database retrieval system