KEGG   Coccidioides immitis: CIMG_02466Help
Entry
CIMG_02466        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
cim  Coccidioides immitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 893 aa AA seqDB search
MMNHHLPPLPHGQPPLPPPRRQHDIPYASAPPNVRSSQAYMGYHHPHPHATGPLPPYAPH
QYQQHWYPYQQMPHPPPPQPYQSYSPLIVSSYPRSQHIAATGPPPSFPLQTPTTASTPQL
SSFSSTPPPIVAPSSATSDLQEDVSTNRPAEAQSKAIDGGSTSSGTALVPSAVVPEASVN
ERTSIEPTAREPFQPPLPWLSVPEAPFPEKLPRRRRKPRIAEVTKQSVSLSFKADSEGNE
PQKPGLEAEPPLPERTATPTPTASHAPSEPTSTQPTTPSSSSNSQSPSHVRQVSQATTPR
MAAPIVPIVPVVPIMPATPHLSKQGQQTTGSATDNTKPIESVQPSQSTADQQDLKATPPP
RSQPKSWADLVRTKKPTSGSDDAVSTSGVGGLAPSKSESLVDVINSLASEADLYSNKIAF
VEPRGLVNTGNMCYMNSQVLQVLVFCVPFYDFLDRVSRRAAHSFKSELPLLDAMIMFMRE
FRVIGSASSVEQLRQRLKQTELEQYGSSFIPEYVYQVIRHLPRFRDMRRGHQQDAQEFLG
FLFEELHEECLHAIKSSSALPEAASASDVDAVSMTDDSAGEGWLEVGHKQKAAVTRSSGH
IASESPITRIFGGNLRSEFRVPGNKNSVTLEPYQSLQLDIGSPQVNNIIDALKGLTRPET
MHGDFSSSRGTKVNATKQVFIESLPPVLILHLKRFHYDSVTKGTQKIWKKIGYPLELEIP
KEVFAPHRRNMLAAQGGGLPKYRLTGVIYHHGKNASGGHYTVEIRRQDGREWIRIDDTVI
RRVRSEDVAFAGSEEDPKSQAAALEQHKSLDSSSQSNIFRHFDQDDEQDSERGWNQVNGS
GSSHASKKSVSALANGTSPPNTASGDSSGKRTSSSRLAARENKVAYLLFYQRI
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccatcatctgcccccgctgcctcacgggcagccgcccctacctcctcctcgc
cgacagcacgatattccctatgcgtcggcgccgcctaatgtgcgctcgtcccaagcatac
atgggctatcaccacccccatcctcacgcgaccggtcctctacccccatacgcaccccat
caataccagcagcactggtatccatatcaacagatgccacaccctccaccaccgcaaccg
taccagtcgtacagtcctttgatcgtctcctcgtaccctcgttcccagcatatcgccgca
accggcccaccaccttcattccccttgcagacccctactaccgcctcaacgccgcagctt
tcgtccttctcctcgacgcctcccccaatcgttgccccgtcatctgccacttcggattta
caggaagatgtatccacaaaccgcccggcggaggcccaatccaaagcaattgatggaggt
tcgacaagctcgggcactgcgttggttcctagtgcagttgttccggaagcctcggtcaat
gagcgcacaagcatagaacccaccgccagagaaccgtttcagccaccgctgccctggttg
tcggttcctgaggccccattccctgagaagctacctcggagacggcgaaagcccaggatc
gctgaagttaccaagcaatctgtgtctctctccttcaaggccgacagcgagggaaatgaa
ccccagaaacccggtcttgaagcagaacccccattgcccgagcgtactgccactcccact
ccaacagcctcccacgccccatctgaacccacctcgacacagccaaccactccttcgtct
tccagcaactcacaatctccgtcccatgttcgccaagtgtctcaggcaaccacgccacga
atggcagccccaatcgttccgatcgttcctgttgttcccatcatgccagctacaccccac
ctttcgaagcaaggacagcagaccaccggaagtgccacagacaacactaaacccattgag
tcagtgcagcccagccaaagtactgctgaccagcaggacttgaaagcaacgcctccacct
cgttcgcagccaaaatcatgggccgaccttgttcggacgaaaaagccaacctcgggaagt
gatgacgccgtgtcaacatcgggtgttggcggtttggctccgtccaagtctgaatctctc
gtcgacgttattaatagcttggcttcagaagcggatctttatagcaataagattgccttt
gttgagcctcgaggtcttgtaaatacgggtaatatgtgttatatgaactcgcaggtcctc
caagttctcgtcttttgtgttccattttatgatttccttgatcgggttagtcgtcgtgct
gcacacagcttcaagagcgagctcccgcttctcgacgcaatgattatgtttatgagagaa
tttcgagtaattggctcggcaagttctgtcgagcagttgcggcaacgtttgaagcagact
gaactagagcaatatgggtcatcattcattccagaatacgtttaccaggtcatcagacat
ctccctcgctttagagatatgcgccgaggccatcaacaagatgcccaagaattcctcggt
ttcttgtttgaagagcttcacgaagagtgcttacatgcaataaagagctcttccgctttg
cctgaagctgcaagtgcttcagatgtcgatgctgtctccatgacagatgattccgctggt
gaaggttggttagaagttggccataagcagaaagccgccgtcacccgatcatcgggacac
attgcttcagaatccccaatcacgagaatcttcggtggcaaccttcgctctgaattcaga
gtccccggaaataaaaactccgttaccttggagccttaccagtcgcttcaacttgatatt
ggctctcctcaagttaataatatcatcgatgcactaaagggccttaccagaccggaaact
atgcacggggattttagctcctcgcgtggtaccaaagtgaatgccaccaagcaggtgttc
attgaaagcctaccaccggtcctgattctccatctgaagcgcttccactatgatagtgta
acaaagggcactcagaaaatttggaagaagattggatatcctttggaactcgaaatcccc
aaggaggtgttcgctccacaccgtcgaaatatgttagctgcccagggtggtggccttccc
aagtataggcttaccggtgttatttatcaccatggcaaaaatgcaagcggcggccactat
acggtggaaatccgccgtcaagatggccgcgaatggatccgtatcgatgataccgtgatt
cgccgcgttcgaagcgaggatgttgcatttgcaggaagtgaggaagatccaaagagccag
gctgctgccctcgagcagcataaatctctcgatagcagctcacagtcgaatatcttccgc
catttcgaccaggacgacgagcaagacagcgagcgtggatggaaccaggtcaacggctcg
gggtcgagccacgcaagcaaaaaatcagtcagcgcgctggccaacggaaccagcccaccc
aacaccgcgtcaggagactcctcgggcaagaggacttccagcagccgattggcagctcgg
gagaacaaggtcgcctatctgcttttctatcagcggatctaa

DBGET integrated database retrieval system