KEGG   Coccidioides immitis: CIMG_02680Help
Entry
CIMG_02680        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cim  Coccidioides immitis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:cim00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 175 aa AA seqDB search
MKAYWYDNKEGDQRARHDSGRAVEESYLSSLGVLYRRCPNISDVDSLASDRGYKNRDEIT
ISPEKMGDVYEEKVKMFFHEHLHEDEEIRYILDGEGYFDVRSEGDEWVRIAVEKDDLLVL
PAGIYHRFTTGESNYIKAMRLFQDEPKWTPLNRSPEVDTNKHRKAYLQSRTVAAA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgtactggtacgataacaaggagggcgaccaacgcgctcgccacgactccggc
cgtgccgtagaagaatcttatctttcaagccttggtgtcctataccgtcgatgccccaat
atctcagacgtcgactccctcgctagtgatcggggctacaagaatcgcgatgagatcacc
atctcccctgagaaaatgggcgacgtctacgaagagaaagtgaaaatgtttttccacgag
catctacatgaagatgaagaaatcagatatatccttgacggagagggttattttgacgta
cggagtgaaggtgatgaatgggtgaggattgcggtggaaaaggatgatctcttggtattg
cctgcgggcatatatcatcggtttacgacaggggagagcaattacatcaaagctatgcgg
ttattccaggacgagcccaaatggacccctttgaatagaagtccagaggttgacacaaac
aagcatcgcaaagcgtatttgcaatctcggactgtggctgctgcttag

DBGET integrated database retrieval system