KEGG   Coccidioides immitis: CIMG_02704Help
Entry
CIMG_02704        CDS       T01114                                 

Definition
calcineurin B subunit
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cim  Coccidioides immitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 222 aa AA seqDB search
MTEQDNNAESYDATKRQQTSSSSQVLNDIVSGSNFDHEEVDRLWKRFMKLDRDKSGTIER
DEFLSLPQVSSNPLSTRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKVYD
IDRDGFISNGELFIVLKMMVGSNLKDMQLQQIVDKTIMEADLDGDGRISFEEFTRMVENT
DVSMSMTLGEWPIDFFPYPFKWNVAQPANRSILSTFGGKFSA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaagacaacaatgcagaatcatatgacgcaacaaagcggcagcaaaccagt
tccagctcgcaagtcctaaatgatattgtgtcaggatctaattttgatcatgaagaagtt
gacaggctgtggaaacgcttcatgaagttggatagagataaatctggcactatcgagcgt
gatgaattcctttccctcccacaagtctcttcgaacccgctttcaacccgaatgatagcc
atctttgacgaagacggcggtggtgatgtcgatttccaagaatttgtgtccggcctatca
gcgttcagctcaaagggcaacaaagaggagaaactccgtttcgcattcaaagtatacgat
atcgaccgcgacggttttatttccaacggagaattgttcattgtattgaagatgatggtg
ggaagtaatttgaaggatatgcagctacagcagattgttgacaagacgatcatggaagct
gatttggacggcgacgggagaataagtttcgaggaatttacaaggatggtggaaaataca
gatgttagtatgagtatgacattgggtgagtggcctattgatttctttccatatcctttc
aagtggaatgttgctcaacctgcgaacagatcaattctaagcacctttggcggaaagttc
tcggcataa

DBGET integrated database retrieval system