KEGG   Coccidioides immitis: CIMG_03007Help
Entry
CIMG_03007        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CIMG_03007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 669 aa AA seqDB search
MSTPSTATATHPANHPHYRYPHQSSFHSNVTAYPAATSSSSSSAAVAATRVTNYNYPCQP
AAAALPPPSSSASKPSQAQPAMAAYQTSTTLPTAQSRRRKPNWNEFYKNGVPKEIIVIDD
DEDDPQNTSAANSVYTSSTVKPSSMASYGNGVAAQPASKKRRTGVETTYDLSYHDPPSYS
VAVQQYGEGSSGTSLSTDRTASLHTTAPTSLGSHGSAPTNNVYYEDAAIGQKRKRVVTRK
AARDEQKRRELEIAGYSTYIPPPKPPIKAKDVYVPVIRDPNFTKHSKVDDDDGHYIVTPD
TNLTDRYSIIKLLGQGTFGKVVEAFDRQKKTRCAIKIIRSVQKYRDASRIELRVLSTLAS
NDETNRNKCIHLRDCFDFRNHICIVTDLLGQSVFDFLKGNGFVPFPSSQIQSFARQLFTS
VAFLHDVNLIHTDLKPENILLVNNAYQTFTYNRTIPSSSHTTNRTARQRRVLLDSEIRLI
DFGSATFEEEYHSSVVSTRHYRAPEIILNLGWTFPCDIWSIGCILVEFFTGDALFQTHDN
LEHLAMMESVVGSRIDTKLVRQVMQGRNGSNPAAKYFNRTRLDYPNQDTPRSSRKYVKAM
KQLQDFIPANNSFNKQFLDLLRRIFVYDPFARIKASEALKHPWFNESIIDDGTEAVRIGQ
MQRERANRA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactccctccactgccactgccacccatccggcgaatcatccgcactaccgatat
cctcaccagtcctccttccactccaacgttaccgcgtaccctgcggccacctcctcctca
tcctcctccgccgccgtggccgcaacccgcgtcaccaactacaactatccctgccagcct
gccgccgccgccctccctcctccctcgtcctccgcctccaaaccatctcaagcccagccg
gccatggcggcatatcagacgtccaccaccctcccaacggcccaaagtcgtcggagaaag
ccgaattggaacgagttctacaaaaatggcgtccccaaggaaattatcgtcattgatgac
gacgaggatgatccacaaaatacatctgcggccaactctgtttacacatcatccaccgtg
aagccttcctctatggcctcctacggcaatggcgtcgctgcacagcctgcgagcaagaag
cgacgcaccggtgtcgaaacgacttacgacctttcatatcatgatcctccaagctactcc
gtggccgtccaacagtatggtgaaggctcttcggggacctcactctctacggaccgtact
gcctctcttcacaccactgcaccgacgtcgttgggatcccacggcagcgccccgaccaat
aatgtgtactacgaagatgccgcgatcggccagaagcgcaaacgggtcgtaacacgcaag
gcagcccgcgatgagcagaaacgtcgagagttggaaatcgctggatacagcacatatatt
ccaccccctaagccgcccatcaaggcgaaggatgtttatgttcctgtgatccgcgacccc
aactttacaaaacattccaaggttgacgacgatgatggccattacatcgtcactcctgat
acaaatttgactgatcgatattcgatcatcaagctgctgggccaaggaacatttggaaaa
gtcgttgaggcttttgataggcagaagaaaacccgttgcgctatcaagatcattcgatct
gtccaaaagtatcgtgatgcctctcgtattgaacttagggtcctatcgaccctggcatcc
aacgacgaaaccaaccgcaacaagtgcatacatcttcgggactgttttgactttcgaaac
catatctgcatcgtgactgatctgctaggacaaagtgtgtttgatttcctcaaaggaaat
ggctttgtacctttcccaagcagtcagatccagagttttgctcgccagttgttcacgagt
gttgcttttctccatgatgtcaacctgatccataccgatttgaagcctgaaaatattctc
ttggtgaacaacgcctatcaaacatttacgtacaatcgcacaattccctcttcatctcat
accaccaaccgtactgcccgtcagcgacgggtgctgctagacagcgagatccggttaata
gatttcggctctgccacctttgaagaggagtatcactcctccgtcgtctcgactcgccac
taccgtgctccagaaatcatcctcaaccttggatggacgttcccctgcgatatctggagc
atcggctgtatcctagtcgaattcttcactggagatgctctcttccagacccacgacaac
ctcgagcatcttgcaatgatggagagcgtcgtgggaagccggatcgataccaagctggtg
agacaagtaatgcaaggacgtaatggatcgaatcccgctgccaagtatttcaaccggact
aggctggattatccgaaccaggatactcctcggtcgtctcgcaaatatgtaaaggctatg
aagcaattgcaggacttcattcctgccaataattccttcaataagcagttccttgacctt
ctccgccggatattcgtgtatgacccgttcgcgcgaatcaaagccagtgaggcccttaag
cacccctggtttaatgagtccatcatagacgatggcaccgaggccgttcgcattggccaa
atgcagcgagagagagcaaatcgcgcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system