KEGG   Coccidioides immitis: CIMG_03030Help
Entry
CIMG_03030        CDS       T01114                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cim  Coccidioides immitis
Pathway
cim00010  Glycolysis / Gluconeogenesis
cim00071  Fatty acid degradation
cim00350  Tyrosine metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CIMG_03030
  Lipid metabolism
   00071 Fatty acid degradation
    CIMG_03030
  Amino acid metabolism
   00350 Tyrosine metabolism
    CIMG_03030
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CIMG_03030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C DUF2378
Motif
Other DBs
NCBI-GeneID: 4563816
NCBI-ProteinID: XP_001243589
UniProt: J3KAF9
AA seq 376 aa AA seqDB search
MAVEILEDPQFEIPKTCKAGVVHNEGPEFVLKVEDVSVPEPGPDEVLIKLNITGLCYSDI
HFMLGDLGGPTMAGNNVRSPGHEGAGVVVKVGSNVKGWRVGDRAGVKPMWDTCGACELCW
GDKETYCPKSISTGLQVSGTYQQYITSPARYTTPIPDGVPDEIAAPIMCSASTVLRSLEE
SKLRPGDWAVFPGGGGGVGIQGVQLAQAMGIRAIAIDTGDAKRALCLEMGAEHFVDFRES
KDVAKEVVELCDGIGAHAVFVTAPQAYRDAISFTGRRVGSKVMCIGLRGWVEFCSRTASA
SEYVFGAHPAQFVFKNMSVVGTLVGSMRDTARALDFAKRGLLKPIYEKWPIARMPEAVEK
LRRGQVAGRYVVDFNA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgaaatcctagaggatcctcaattcgagatccccaagacctgcaaagcgggt
gttgtccacaatgaaggccctgaattcgtcttgaaggtggaagatgtatctgtgcccgag
cctggacccgatgaggtccttatcaaattaaacatcaccggcctctgctactccgacata
cacttcatgctgggggacctgggagggcctacaatggcagggaacaacgtccgatcgcct
gggcacgaaggcgctggtgttgttgtcaaggtgggctcgaatgtgaagggctggagagtc
ggtgacagagcgggcgtgaagccgatgtgggatacatgtggtgcctgcgagctgtgctgg
ggcgacaaggagacttactgtcccaagtccatctccacgggtctacaggtctctggaacg
tatcagcagtatatcacgagtccggcgagatacacgaccccgatccccgacggtgttcct
gatgaaatagccgcacccatcatgtgcagtgcttcgacggtgctccgcagccttgaggag
tccaaactccgaccgggtgactgggcggtgttcccggggggaggaggaggagttggcatc
cagggggtccaactcgcccaggccatgggaatacgcgcgattgcaatcgataccggggac
gcaaagagagcactgtgcctggagatgggtgccgaacactttgttgacttccgcgagagc
aaagatgtcgcgaaagaggtcgtggaactctgcgacgggatcggtgcccatgcggtgttt
gtgacggcgccacaggcctacagggacgctatctctttcaccggcaggcgggttgggtcc
aaagtgatgtgcatcgggctccggggttgggttgagttttgttcgagaacagcatcggcg
agtgaatatgtgtttggggcgcacccagcacagtttgtcttcaagaacatgtcggtcgtc
ggtacgctggttggatcgatgagggacacggcgcgggcgctggactttgcgaaacgcgga
ctgttgaagccgatctacgagaaatggccgatcgcccggatgcccgaagccgtcgaaaaa
ctccgacggggacaggtcgcggggcgatacgtagtcgacttcaacgcataa

DBGET integrated database retrieval system