KEGG   Coccidioides immitis: CIMG_03224Help
Entry
CIMG_03224        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cim  Coccidioides immitis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CIMG_03224
Enzymes [BR:cim01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CIMG_03224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 964 aa AA seqDB search
MPFKPFKPPLIRRPPSAPQTQQDTSDSVSQPSAKRRRIGDHASDVATEEGVKPNGTVHVV
KSGQALYRKPLILANNSSKLLDKTGRNDTASGDGGDGGVEGYYNVLWRKFTAKKHRTWDG
DGILSLRGGYAYLQDVSGKDMGRIMFNSPLKPGSALSIGGKDVEVDSILSKEEYLAGRPF
LGVNRESPDVLLKKPELPRMTPISVSRIGSVRKPDATKPAVIGRRAEVREAEEAVKKVLN
VAAPKSIATNSRFKNPLKEDSVLPSKPNKEVTPRHDPNQPGAIVMKRPESVPKGKQIVDV
VVDPLLGKHLREHQREGVKLLYECVMGMRPFNGEGAILADEMGLGKTLQTIALLWTLMKQ
NPIYGASPVVKKALIVCPVTLIKNWQKEFRKWLGNDRLGVFVADGKHMRLTDFTMGMSYN
VMIIGYERLRTVQEELAKGRGIDIVIADEGHRLKTVQNKSAQAIQSLNTARRIILSGTPI
QNDLSEFFAMVDFVNPGLLGTFKMFMKEFEGPIVKSRQPGASKKDIEKGEARSEELAGLT
SKFILRRTADILSKHLPPKTEYILFCNPTPAQANIYRHVIASPIFQSALGDSESALQLIT
ILKKLCNSPSLLTLKVLKDENPNCTISSLISTLPPNLLRHFSPASSGKIRVLDQLLHNLH
STTSEKIVLVSNYTSTLNLLAALLSSLSLPYLRLDGSTPASKRQFLVDDFNRSSSKSCFA
FLLSAKAGGIGLNLTGASRLVLFDVDWNPATDIQAMARIHRDGQKRHCHIYRMLLRGGLE
EKIWQRQVTKLGLADSVMDQKNSVAHFSREELRDLFRLDEDAECQTHDLLGCECGGRGKH
ASIIADVGDNGDKLSDSESPTESDDSDEIPDPPSLIKASKLLSHPSAGERKNAANKRRRK
MRSLMQYSHISTQLLVTKHRKSLEEQIGDDVLLSLLGEEGNGVRYLFKRDGFAGLSTNTD
KMGI
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgccattcaagccctttaagcctccgctcatccggaggccgccctccgctccccaaacg
cagcaggatacctctgattcggtttcccagccctccgctaaacggcgtcgtatcggcgac
cacgccagcgatgtagcgactgaagaaggagtgaagcctaatgggaccgtacatgttgtg
aaaagtggccaggctctctatcggaaaccgttgatcttggcgaataactcgtccaagctt
ctcgataagactgggcggaatgacacggcaagcggcgacggcggcgacggcggcgtagag
ggctactacaatgttctttggcgaaaatttacggccaaaaagcataggacatgggacggt
gacgggatcttgtcccttcgaggtggctatgcctatctccaagatgtttctggaaaggac
atggggcggatcatgttcaattctcccctaaaacctggctcagcgctgtccattggcggg
aaggatgttgaggtcgactcaatactttccaaggaagaatatctcgccggtcgtccattc
ctcggcgtaaatagggagtcgcctgatgtattattgaagaagccagagctaccgcgaatg
acaccgattagtgtctctcgcattggttccgtacgaaaaccagatgctactaagccggca
gtgattgggaggagggcagaagtacgtgaggccgaagaagctgtaaaaaaggtgcttaat
gttgcagcaccaaaaagtattgcaacgaatagtcgtttcaaaaaccccttgaaagaagac
tctgtactgccgtcgaaaccgaacaaagaagtcactccacgacatgacccaaaccagccg
ggagcaatcgtgatgaaacgcccagaatcagttccaaagggtaagcagatcgttgatgtc
gtcgttgaccctctcctgggaaaacatcttcgcgaacatcagcgcgagggtgtcaagctt
ctttacgaatgcgttatgggaatgcgccctttcaacggtgaaggggccatccttgcggat
gaaatgggacttgggaaaacattacagacaatagctttgctgtggactctaatgaagcaa
aatccaatatacggggcatccccagtggttaaaaaggctctcatcgtatgcccggtgacg
ctgattaagaattggcaaaaagaattcagaaaatggttaggaaatgatcgacttggcgtg
tttgttgcggatggaaaacacatgaggcttacggattttacaatgggaatgagttataat
gttatgatcatcgggtatgaaagattacgaactgtgcaagaggaattggccaaaggtcgt
gggattgatatcgtcatcgcagatgaagggcacagattgaagaccgttcagaataaaagt
gcccaggcgattcaatcccttaatactgctcgacgtatcattctttcgggaacgccgatt
caaaacgacttgagtgagttcttcgctatggtggattttgtcaaccccggtctgttgggc
actttcaaaatgtttatgaaagaatttgaaggccctattgtgaagtccaggcagccaggc
gcgtccaagaaggacatcgaaaagggtgaggctagaagcgaggagttagcaggtctaacg
tccaagtttatcttgcgccggaccgcagatatcctttctaagcatctcccacccaaaact
gaatatatcctgttttgcaatccgactcctgcccaagcgaatatataccgccatgtgatc
gcctctccgatattccagtcagcactcggagactcggagagtgctttgcagcttattacg
attctaaagaagctctgcaatagtccttctttgctcactctgaaagtcttaaaggatgag
aacccgaattgtacaatcagctctctcatatcgaccctcccacctaatctgcttcgacat
ttttcacccgcatcgagcggcaaaattagagttctggaccagctgctccacaacctgcac
agcacaacgtcggagaagattgtgctagtgtcaaactacacatcaactctcaaccttctc
gccgctcttttgtcgtctctatccctcccatatctacgcctcgatggttctaccccagcc
agcaaacgtcaattccttgttgacgattttaaccgctcgtcatccaaatcctgcttcgca
tttctcctttctgcaaaagctggggggatcgggctcaatctcaccggcgccagccgcctg
gtgctctttgatgtggactggaatcccgcgacggacatccaggccatggcgcgtatccat
cgtgacgggcaaaagagacactgtcacatctaccgaatgttacttagaggcggactcgag
gagaagatctggcaaagacaagttacgaaacttggtctggcagatagcgtgatggatcag
aaaaacagcgtggcgcatttttctagggaagaattgagagatttgtttagactcgatgag
gatgccgagtgtcaaacacatgaccttttaggctgcgagtgcggggggagaggaaagcat
gcttcaattatagcggatgttggcgataatggggacaagttgtctgactccgagagcccc
acggagagtgacgattcagatgaaatcccagatccgccttcgctaatcaaggcgtctaaa
cttctcagccatccatcagccggcgaaagaaaaaatgctgccaacaagagaagaaggaaa
atgcgctctctcatgcagtattctcacattagcactcaacttctcgtcaccaaacataga
aaatcactagaagagcagattggcgacgatgttcttttgtcgttactcggagaagaaggc
aacggggtccgatacttgtttaaacgggatgggttcgcagggttatcgacaaatacagac
aaaatggggatttaa

DBGET integrated database retrieval system