KEGG   Coccidioides immitis: CIMG_03683Help
Entry
CIMG_03683        CDS       T01114                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cim  Coccidioides immitis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CIMG_03683
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CIMG_03683
Enzymes [BR:cim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CIMG_03683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 322 aa AA seqDB search
MTSPSTIKQKFIAKGHQLGVVAVGFSDGQPNQGVDPSGLIEAGLLDQLRDDLEYDIRHDG
KVHTYAEFVPEHDPNHRGMKKPRTVSAATQQLSRQVYEHAREGRLVLTLGGDHSIAIGTI
SGTAKAIRERLGREMAVIWVDAHADINRPEDSDSGNIHGMPLAFLTGLAKDDNEDMFGWL
QPDNLISPRKLVYIGLRDVDRAEKRLLKEHGIKAFSMHDIDKYGIGRVVEMALAHIGQDT
PIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFIAESIHETGSLVAMDLVEVNPTLETL
GASETIRAGCSLVRSALGDTLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacatctccaagcaccattaagcagaaattcatagcaaagggacaccagctcggcgtc
gtggccgttggtttctcggatggccagcccaaccaaggcgtcgacccctccggcctcatc
gaagccggacttcttgaccagctccgcgatgatctagaatacgacattcgccatgacggc
aaggtacacacatacgccgaattcgtgcctgaacacgatccgaaccaccggggcatgaaa
aagcctcgaaccgtgagtgccgccacccaacagctaagcaggcaggtctacgagcacgca
cgcgagggcagactagtgcttaccctcggcggagaccactccatcgccatcggtaccatc
tctggaaccgcgaaggcgatccgggaacggttgggacgcgagatggctgtgatctgggtg
gatgcacatgcggatattaacaggccagaggacagcgacagtgggaacatccacggcatg
cctcttgcgtttttgaccggattggcaaaggatgacaacgaagatatgtttggctggttg
cagccggataatctgatcagccctaggaaattggtatatatcggactaagagatgtggat
cgcgcagagaagagactgctgaaggaacatggtatcaaggcctttagcatgcatgacatc
gacaagtatggtattggccgtgtggtggagatggcccttgcgcatattggtcaagatacg
cccatccatctctcctttgacgtggatgctcttgacccacagtgggcacccagcaccgga
actcccgtccgaggaggtttgacgctccgtgaaggtgactttattgccgaatccatccac
gaaaccggcagtctagtggcgatggacttggtagaggtcaacccaaccctcgagacattg
ggagctagcgagacaatccgtgctggatgctcgttggttcgaagtgcactgggagacacc
cttctgtaa

DBGET integrated database retrieval system