KEGG   Coccidioides immitis: CIMG_03683Help
Entry
CIMG_03683        CDS       T01114                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cim  Coccidioides immitis
Pathway
cim00220  Arginine biosynthesis
cim00330  Arginine and proline metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
cim01130  Biosynthesis of antibiotics
cim01230  Biosynthesis of amino acids
Module
cim_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    CIMG_03683
   00330 Arginine and proline metabolism
    CIMG_03683
Enzymes [BR:cim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CIMG_03683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 4563496
NCBI-ProteinID: XP_001244242
UniProt: Q1E180
AA seq 322 aa AA seqDB search
MTSPSTIKQKFIAKGHQLGVVAVGFSDGQPNQGVDPSGLIEAGLLDQLRDDLEYDIRHDG
KVHTYAEFVPEHDPNHRGMKKPRTVSAATQQLSRQVYEHAREGRLVLTLGGDHSIAIGTI
SGTAKAIRERLGREMAVIWVDAHADINRPEDSDSGNIHGMPLAFLTGLAKDDNEDMFGWL
QPDNLISPRKLVYIGLRDVDRAEKRLLKEHGIKAFSMHDIDKYGIGRVVEMALAHIGQDT
PIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFIAESIHETGSLVAMDLVEVNPTLETL
GASETIRAGCSLVRSALGDTLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacatctccaagcaccattaagcagaaattcatagcaaagggacaccagctcggcgtc
gtggccgttggtttctcggatggccagcccaaccaaggcgtcgacccctccggcctcatc
gaagccggacttcttgaccagctccgcgatgatctagaatacgacattcgccatgacggc
aaggtacacacatacgccgaattcgtgcctgaacacgatccgaaccaccggggcatgaaa
aagcctcgaaccgtgagtgccgccacccaacagctaagcaggcaggtctacgagcacgca
cgcgagggcagactagtgcttaccctcggcggagaccactccatcgccatcggtaccatc
tctggaaccgcgaaggcgatccgggaacggttgggacgcgagatggctgtgatctgggtg
gatgcacatgcggatattaacaggccagaggacagcgacagtgggaacatccacggcatg
cctcttgcgtttttgaccggattggcaaaggatgacaacgaagatatgtttggctggttg
cagccggataatctgatcagccctaggaaattggtatatatcggactaagagatgtggat
cgcgcagagaagagactgctgaaggaacatggtatcaaggcctttagcatgcatgacatc
gacaagtatggtattggccgtgtggtggagatggcccttgcgcatattggtcaagatacg
cccatccatctctcctttgacgtggatgctcttgacccacagtgggcacccagcaccgga
actcccgtccgaggaggtttgacgctccgtgaaggtgactttattgccgaatccatccac
gaaaccggcagtctagtggcgatggacttggtagaggtcaacccaaccctcgagacattg
ggagctagcgagacaatccgtgctggatgctcgttggttcgaagtgcactgggagacacc
cttctgtaa

DBGET integrated database retrieval system