KEGG   Coccidioides immitis: CIMG_04063Help
Entry
CIMG_04063        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CIMG_04063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MDSLSTWIQSLPPPAEFFPPTPKAYSTLLSIFQYFPIITIAQWLLPFYPQGKTSLPTSIL
NFPGRYAWCFMESIGAMNMLYILYTHFQSIPNFLSTMPAWNKLLVALYILHYVNRAFITP
LFLAPSMSPIHLIIIFTAVTYNYFNSSCLAGWLLGYGLPVSASGEHIIATTTSAANTPIH
AWLPYVPYIGIALYFLGMYGNIHAETTLFRLRREEAHRRQQKAKKDGDATNSRKSIYDKV
YVIPPPTGVFRSILFPHYVLEWLEWAGFLLIGFAVASQTSHTPSASAKTPYIPLAPYYTP
LAKLFLQRWGLPFPFPAIVFLVNTVLTTGARASWGRKWYAQRFGEKAVAARGGFVPYFKW
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggactctctctctacttggattcaatccttgcctccgcccgctgaattcttcccgccc
acaccaaaggcatactctaccctcctttcaatattccaatactttccgataataaccata
gcccaatggctcctccccttctacccgcagggcaaaacgtccctcccgacctctatcctg
aatttcccaggccgctacgcgtggtgcttcatggagagcatcggcgccatgaacatgttg
tacatcctctacacgcacttccagtccatcccgaatttcctatctacaatgccagcctgg
aataaactcctcgtggctctctacatcctccactacgtcaatcgcgctttcatcaccccg
ctgtttttggcacccagcatgtcgcccattcacctgatcataatcttcacggcggtgaca
tacaactacttcaattctagctgcctcgcgggctggctcctcggatacggcctacccgtc
agtgcttccggcgaacacatcatagccaccaccacctccgccgccaacacacctattcac
gcctggcttccctacgtgccctacatcggcatcgccctctacttcctaggcatgtacggc
aacatccacgccgaaaccactctcttccgtcttcgcagagaagaagcccaccgcagacaa
caaaaggcgaaaaaggacggcgacgcaaccaacagcagaaaatccatctacgacaaagtc
tacgtcatcccaccgcctactggcgtcttccgctcaatcctcttcccgcactacgtcctg
gaatggcttgaatgggccgggttcttgctcatcgggtttgccgtggcctcgcagacatcc
cacacaccctctgccagtgccaaaacaccgtatattcccttggccccatattacacgccg
ttggcaaagttgttcttgcaaagatggggcttgccgttcccgttcccggcgattgtattc
ctagtgaacaccgtgttgaccacgggggcaagggcgtcatgggggaggaagtggtatgcc
cagcggtttggggagaaggccgttgctgcaagaggggggtttgttccttatttcaagtgg
ttgtga

DBGET integrated database retrieval system