KEGG   Coccidioides immitis: CIMG_04121Help
Entry
CIMG_04121        CDS       T01114                                 

Definition
(RefSeq) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cim  Coccidioides immitis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CIMG_04121
Enzymes [BR:cim01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CIMG_04121
Peptidases [BR:cim01002]
 Cysteine Peptidases
  Family C44
   CIMG_04121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 572 aa AA seqDB search
MCGIFACHCHPDVQKFKPTALRMAKAVRHRGPDWSGNFVSNNTILAHERLSIVGVESGAQ
PLVNDDETLALAVNGEIYNHRILRKGLKTQYKFKTHSDCEVIIPLYMEHDIDAPKFLDGM
FSWVLFDKKQNRVIAARDPIGITSFYQGWSSQTPGAVYFASELKSLHPVCDKIISFPPGH
VYDSKTDTMTRYFQPKWWDPTNVPSTPIDYKLIRESLVRSVRKRLMAEVPYGVLLSGGLD
SSLVASIAQRETQRMMVAQNGTVTNGESGAGLVGIDDSNELSTVTSFPQLHSFSIGLPGA
PDTKAALEVANFLGTKHYAFTFTVDDGLNALSDVIYHLETYDVTTIRASTPMYLLSRKIK
AMGVKMVLSGEGSDEIFGGYLYFHAAPDKKAFHEETVRRVKNLHLADCLRANKSTSAWGL
EARVPFLDKQFLEVSMGVDPQEKMITKERIEKYVLRKAFDTSDEPETKPFLPDNILWRQK
EQFSDGVGYSWIDALRDNAELQVTDEMMKNPKPEWGDDIPDTKEAYWYRMMFDEHFPPCC
ASTVMRWTPTWSKQTDPSGRAISTHVAKYDHA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatatttgcgtgtcactgtcaccctgatgtacagaaattcaagccgacggct
ttacgcatggcgaaagccgtccggcatcgtggtcctgattggagtggtaactttgtttcc
aacaacacaatccttgcacacgagcgattgagcatcgtcggtgtcgaatctggtgctcag
cccctcgttaacgatgacgagacattggcactcgctgtcaatggagaaatttataatcac
agaatcctgaggaagggattgaagacccaatataaattcaagacacattcggactgcgaa
gttatcattccattgtatatggaacatgatatcgatgctccgaaattcctcgatggcatg
ttctcgtgggtgctttttgacaaaaaacagaaccgcgttattgctgccagagatcccatt
ggtatcaccagcttctaccaaggatggtcttcccagacacctggtgctgtctatttcgcc
tctgaattaaagtcacttcatccggtctgcgacaagatcatctccttccctcccggccat
gtgtatgactccaagacggacaccatgactcgttacttccagccgaaatggtgggatcca
accaatgttccgtcgacccccatagattacaaattgatccgcgaatctttggtgcgatct
gttcgtaagagactgatggcagaggttccctatggtgtcctgctctctggtggtttggac
tccagcctggtcgcctcgattgcgcagcgcgaaacccagcggatgatggtggcgcagaac
ggcacggtcaccaatggagaatcgggcgcgggcttggttggaatcgacgatagcaacgag
ctgtcgactgtgacttccttcccccaattgcattcgttctccattggtcttccgggagcc
ccagataccaaggctgctcttgaggtcgctaactttcttggaacaaagcattacgctttc
acattcacagtcgacgacggccttaacgcactctcagacgttatctatcacttggaaact
tatgatgtgacaactatccgtgcttctacacccatgtatctgctgagcagaaagatcaag
gccatgggcgtcaagatggtgctcagcggtgaaggtagcgatgaaatttttggcggatat
ctttatttccacgcggccccggataagaaagctttccacgaggagacggttagacgagtt
aagaaccttcacttggctgactgcttgagagcaaacaagtcaacttcggcatggggtctt
gaggcccgtgtgccgttcttggataagcaattcctggaggtctccatgggtgttgatccg
caggaaaagatgatcaccaaggaaagaatcgagaagtacgtcttgaggaaagccttcgac
acgtctgatgagccagaaaccaagccgttcctgccggataacattctgtggcgccagaaa
gaacaattcagcgatggtgtcggctattcctggattgatgctctaagggacaacgcagag
cttcaagttacggatgagatgatgaagaaccccaagccagagtggggcgatgatatccct
gatacaaaggaggcgtactggtaccgaatgatgttcgatgaacacttccctccgtgctgc
gcgtccactgtcatgcgctggacacccacatggtcgaagcaaacggacccaagtggacgt
gccatctcgacccacgttgcgaaatacgaccacgcatag

DBGET integrated database retrieval system