KEGG   Coccidioides immitis: CIMG_04183Help
Entry
CIMG_04183        CDS       T01114                                 

Definition
(RefSeq) longevity-assurance protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
cim  Coccidioides immitis
Pathway
cim00600  Sphingolipid metabolism
cim01100  Metabolic pathways
Module
cim_M00094  Ceramide biosynthesis
cim_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CIMG_04183
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CIMG_04183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 4562548
NCBI-ProteinID: XP_001244742
UniProt: J3KCY9
AA seq 449 aa AA seqDB search
MAKPARSHSNSVTEVEACVSSPEGRGSIRKDASLRERLLSNQIGISLTILTMIFAVHNLY
PSLRPYTSPFLTLPHYRSTKGIYVQGWDDLYFIIGSMVAFTAIRAIAIDWILMPIAQQLG
LKLKASLRFAEQGWLLVYYIVFWSYGLYIWMNSKYWMDFREIWTDWPSREIPGYFKLYCL
LQLSFWLQQIFVINIEERRKDHYQMLTHHIVTSTLLGSAYVYSFYNVANVVLCIMDIVDF
LLPAAKMLKYMGYERICTIAFGVFLATWFIARHVIYMMLWWSIYQNVPDAMSFGCYLGAT
GQKLIDVSPDSWGSLIYPFRDIDGPICMSFRIKWAFLTLLLILQMLSLIWFGMILRVAVH
VLRTGSSAEDTRSDDEGEESTEAVRPVRRGSPRRQEDYEENGWSKSVAVNGSAQNHHPVR
IRTARGRVTLSDQNERKALLGRIGCDKPS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagccggcccgtagccattccaactctgttacagaggtcgaggcctgcgtttcg
tcgccagaagggagagggtccatcaggaaagatgccagtcttcgagaacggctgctcagc
aaccaaatcggaatctcccttaccattcttacgatgatcttcgcggttcacaacttatac
ccttcgcttagaccatacacgtctcctttcttaactttgccacattaccgatcgacaaaa
ggaatatacgtccagggatgggacgacttgtacttcatcatcggttccatggtcgccttt
acagcaatccgagccatcgcaattgactggatccttatgcccatcgcacaacaacttggg
ctaaagttgaaggcatcgttgagattcgccgaacaaggctggctactggtgtattacatt
gtcttctggtcctatggtttgtatatttggatgaattcaaagtactggatggatttccga
gaaatttggacggactggccgtcgagagagataccaggctatttcaagctgtattgcctg
ttgcagttgtcattttggttgcaacaaattttcgtcatcaacattgaggaaagaagaaaa
gaccattatcagatgttgacgcatcatatcgtcacaagcacccttctcggatcagcttat
gtttacagcttctataacgtggccaacgttgttctatgtattatggatattgtagatttc
ctcctcccggctgcgaagatgctaaaatatatgggttacgagcgcatttgcaccattgca
ttcggggtcttcctagccacatggttcattgcccgccatgtgatttacatgatgttatgg
tggtccatttaccaaaatgttccagatgcaatgtcatttggatgttatctgggcgcaacc
ggccagaagcttattgacgtatctcccgattcctggggctcactcatatatccgtttcgg
gatatcgatggacctatttgcatgagtttccgcatcaaatgggcctttctcactctgctc
ctaatacttcagatgctctctcttatctggttcggcatgatccttcgtgtggcagtgcat
gtgcttcggacaggctcatccgcggaggatacccgcagcgacgatgagggcgaagaatca
actgaggcagtccgccctgttcgccgaggcagccctagaagacaggaagattatgaagag
aatggatggagtaaatctgttgcggtcaacggttccgcccagaatcatcacccggtgcga
atcagaacagctcgcggccgcgttacactcagcgatcagaacgaacgaaaggctttactc
ggcagaatcgggtgcgacaagccttcttaa

DBGET integrated database retrieval system