KEGG   Coccidioides immitis: CIMG_04344Help
Entry
CIMG_04344        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cim  Coccidioides immitis
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cim00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:cim00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 309 aa AA seqDB search
METTLAAARYGKENVKVCKVHRDTTTGWQTVTEMTVSVLLEGDIESSYTKADNSVVVATD
SMKNTIYILAKQHPVTSPELFASIIGSHFIEAYKHIHAAHVHIVAHRWTRMAIDGKLHPH
SFMRDGTDVRIADADVIEGKGIEIKSSISGLLLLKSTGSQFHGFIQDEFTTLPETWDRIL
STEIDANWTWMPFENLDHVKSVVPKFDRAFSSARDISLRLFAQDDSASVQNTMYKMASEI
LGTEPLLKAVSYSLPNKHYLELGLSWHKGLKNVGKDAEVYVPTSAPNGLIQCTVARGTDR
YIRATTSKL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaccaccctagccgcggcacgatatggaaaggagaatgtcaaagtgtgcaaggtt
caccgtgataccacaactggttggcaaacagtcacggaaatgacagtcagtgtgttgctg
gagggtgatattgaaagctcatacaccaaagccgacaatagcgtcgttgttgcaacggat
tctatgaaaaataccatatatatattggccaaacagcatcctgtcacttctcccgagctt
tttgcgtctattatcgggagtcatttcatagaggcatataaacatattcatgcggcgcat
gtccatatcgttgctcatcggtggacaagaatggctatcgacggaaagctacacccacat
tcattcatgcgcgatggtacggatgtccgaatcgcagacgccgatgtcattgagggcaag
gggattgaaatcaaatcttcgatctctggccttctccttctcaagagcacaggatcccaa
tttcacgggttcatacaagatgaattcaccacgttgcctgaaacctgggacaggatttta
agcacagagattgacgcgaattggacttggatgccatttgaaaacctcgaccatgtcaag
tccgtagttcctaaattcgaccgggccttctcttcggcgcgagatatcagtttaaggctc
tttgcgcaagatgatagcgcaagcgtgcaaaacacaatgtataaaatggctagtgaaatc
cttggcactgagccgttgctgaaagctgtgtcgtactcgcttcctaacaagcattacctt
gaactaggtctgagctggcacaaaggactgaaaaatgttggtaaagatgcagaagtatat
gtgccgacctcggcgccgaatggcttaattcaatgcacggttgcgcgtggaactgaccgc
tacatacgggcgacaacttcaaagctctaa

DBGET integrated database retrieval system