KEGG   Coccidioides immitis: CIMG_04365Help
Entry
CIMG_04365        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cim  Coccidioides immitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2372 aa AA seqDB search
MSQSSSATDALPKLFLELKSKNEETRLRAATELYDNVVAASRELPQDKFLEYYNTVSQRI
AQLVVTGGDANEKVAGLLALDRLIDFDGVDAALKTTRFSGYLRSALRSNDNAVLLYAARS
LGRLAKPGGALTAELVESEIQSALEWLQSERQENRRFAAVLVIRELAKGSPTLIYGFVAQ
ILELIWVAIRDPKVLIRETSADAISECFEIISARDSQVRHQWFAGIYDETLLGLRSTNVD
WIHGSLLALRELLLKGAMFMNEHYRNACEIVLRLKDHRDPKIRTQVVATIPVLASYAPLD
FTNTYLHRFMIYLQAQLKREKERNAAFIAIGKIASAVGNAIVNEAPMLECLSMLSMAVGQ
TLSKYMESLLDPIFACGLSKALTQALVDMAHYIPPIRATVQEKLLDMLSLVLCGRPFQPL
GCPDNRAPPMPSFVKESAPPPQEVTDSEITLALLTLGSFDFSGHILNEFVRDVAIKYVDN
DNSEIRKASALTCCQLFVHDPILNQTSSHSLQVVSQVIDKLLSVGVGDPEPEIRCTVLQS
LDRKFDRHLAKPENVRCLFLAVNDEVFSVREAAISIIGRLSNVNPAYVFPPLRKLLVNLL
TGLSFATTSRQKEESAQLISLFVTNATKLVRSYVDPMVTTLLPKTTDLNAAVSATTIKAI
GEIATIGGEGMKQYLAQIMPIILEALQDLSSPSKREAALRTLGQLASNAGYVIEPYKEYP
QLLAVLINIIKTEQAGSLRKETIKLIGTLGALDPYKYQQISQDTPDVHHINEIQAVSDVS
LIMQGLTPSNEEYYPTVVINTLLHNILSESSLAQYHSAVIDAIVTIFKTLGLKCVPFLGQ
IIPAFISVIRDTPVSRLDTYFNQLAILVTIVRQHIRAYLPEIIVVIREYWDASYQVQATI
LSLVEAISKSLEGEFKKYLAGLIPLMLETIEKDSSPRRQPSERVLHAFLVYGSSAEEYMH
RIVPAIVRLFDKQQAPQNIRKSAIETLAKLSRQVNVSDFASLMIHPLARAIGSSDRTLRQ
SALDCVCTLIFQIGQDFTNYIQLINKVLYPFRSLQFLATNVQQVLKNNQIHHHNYQILVS
KLQKGEPLPQDLNPDEQYGSFGDDQSFGEVGQRKILVNQQHLKNAWDATQKSTREDWQEW
MRRFSVELLKESPSHALRACASLAGIYQPLAKDLFNAAFVSCWTELYHTYQEELVHSIDL
ALTARNIPPEILQILLNLAEFMEHDDKALPIDIRTLGKYAGKCHAFAKALHYKELEFEQD
QNSGAVEALISINNQLQQFDAAIGILRKAQAYRDVELKETWFVKLQRWEEALAAYKRREL
IDPDSFEVTMGKMRCLHALGEWKMLSDLAQEKWNQATNDHRIAIAPLAAAAAWGRGQWEL
MDSYIGVMKEQSPDRSFFGAILSLHRNQFKEAAEYIEKARNGLDTELSALLGESYNRAYN
VVVRVQMLAELEEIITYKQSAGDPEKQEAMRQTWNKRLLGCQQNVEVWQRMLKVRALVIS
PRENLDMWIKFANLCRKSNRMGLAERSLASLEAVESSEFGIPPEVTYARLKFDWAAGRQQ
EALQALKDFTASLTEEYGKYNSLVSAARGQQQQAAENNHMTNGQTEQREAEIAAIRQHLG
DLGKFRRLLAKSHLKQGEWQTALQRGDWRSENVCDVLNAYSAATHYNRESYKAWHAWALA
NFEVLNALSPQSNNETVSIPHHIISEHVVPAIQGFFRSIALSSSSALQDTLRLLTLWFTH
GGDADVNSVVTDGFATVSIDTWLEVTPQLIARINQPNPRVRAAVHRLLADLGKAHPQALV
YPLTVATKSNVVRRSQSAIHIMDSMRQHSPRLVEQAEVVSHELVRVAVLWHELWYDGLEE
ASRLYFANHNVEGMFATLAPLHDMLDKGAETLREVSFAQAFGRDLAEARHFCLLYRETQE
IGDLNQAWDLYYTVFKKIDRQVRHMRTLDLKYVSPKLKDAVDLDLAIPGTYQSGKPVIRI
LSFDPVLTLVQTKKKPRKMIVKGSDGNSYMYALKGHEDIRQDERVMQLFGLVNTLLEKDS
ECFKRHLTIQRFPAIPLSQNSGLIGWVTNTDTLHALIKEYRESRRILLNIEHRIMLQMAP
DYESLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRSLGVMSMVGYI
LGLGDRHPSNLLLDRITGKIVHIDFGDCFEVAMHREKYPERVPFRLTRMLTFAMEVSNIE
GSYHITCEAVMRVLRENKESLMAVLEAFIHDPLINWRLGARESPAQPSFADRRQSGELDL
DHPLQPGNFTRRRPSILDGGILDAQQGIPNEAREVQNARALQVLGRVREKLTGRDFKPHE
ELNVSDQVDKLLVQATSVENLCQHYIGWCSFW
NT seq 7119 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcatcatctgcaaccgatgcgctcccgaagctcttcctagagctcaagtcg
aaaaacgaggaaacaaggctgcgagcagcgactgaactatacgataatgtagtagcagcg
tcgagagagctcccgcaggataaattcctcgagtattataacacggtcagccagcgaata
gctcagctcgtggttacagggggcgacgcgaatgagaaggtggccggacttcttgcgctt
gataggttgatcgatttcgacggtgttgatgctgccctaaagacaacgagattctctggc
tacttgcgtagcgcattgaggagtaacgataatgcagtgttgctttatgcagccaggtcg
ctggggcgcctagcaaaacctggcggtgcattaactgcagaattggtggaaagtgagata
caatcggcactagaatggttgcaatcggaaagacaagagaatcgacgttttgctgccgtg
ttggtcatcagggaactcgccaaaggctccccaactctcatctacggattcgttgcgcaa
atacttgaacttatctgggttgccatccgtgatccgaaagtgcttatccgagagacgtct
gctgatgctatcagcgaatgctttgaaattatttcggctcgagatagccaggttcgccat
cagtggtttgcgggaatctacgatgagacgctacttggtctaagatcaacgaacgtggat
tggatccatggctctctccttgcgcttagagaattgctccttaaaggggccatgtttatg
aacgagcactaccgcaacgcttgtgagatagttctccggctgaaagaccaccgagacccc
aaaatccggacccaggtggtcgctacaatccccgtgcttgcatcatatgctccattagac
tttacgaatacttatctccatagattcatgatatacctacaggcgcagctaaagcgagag
aaagagcggaatgccgcgttcatcgctatcggtaagattgctagtgctgtggggaacgcg
attgtgaacgaagctccaatgctagaatgcctcagcatgctatctatggccgtggggcaa
actctcagcaagtatatggaatctcttctcgaccctatctttgcctgtggcctgagtaaa
gctctcactcaagctctagtcgatatggcacattatattccgcctatcagagccacggtc
caagaaaagctgctcgacatgttaagtttagttttgtgtggaaggcccttccaacccctt
ggctgccctgacaatcgcgccccgcctatgccgtcttttgtgaaagaatctgcaccgcca
ccccaagaagtcactgacagcgagattacccttgccctgctaacactagggagcttcgac
ttctctggccatatattgaacgagtttgtccgcgatgtggctataaaatacgtggacaat
gataactccgagatccgcaaagcatccgccttgacttgttgtcaactgtttgtccatgac
cctattctcaaccagacaagcagccattctctccaggttgtcagccaggttatcgacaag
ctcttatctgtaggagttggtgaccctgaacccgaaatccgctgcacggtattacaatca
ctggatcgaaaatttgatcgtcatttagccaaaccggaaaatgttcgctgcctttttctc
gctgtcaatgatgaagtgttctccgttcgagaagcagcaattagtataattggtcgttta
tcaaacgtcaatcctgcttatgttttcccaccgttgcgaaagctgcttgtcaatcttcta
acggggcttagttttgcaacgacgtcccgtcaaaaggaagaaagtgctcagttgattagt
ttgtttgtcacaaatgcaaccaaattggttcgctcctacgttgacccaatggtcacgact
ctattgccgaagacaacagacctcaatgccgcagtgtcagcgactaccataaaagcaatc
ggagaaatcgcaaccattggcggtgagggcatgaagcaatacctggctcagattatgcct
attatattggaagctttacaagatctgtcctcgccctcaaaacgagaggccgctttgcgc
actcttggacagcttgcgagcaatgccggctacgttatcgagccctataaggaataccca
caactccttgctgtcctcattaacatcatcaaaacggaacaagccgggtcccttcggaaa
gaaactatcaagctcattggcaccctaggagctctcgacccctacaaatatcagcaaata
agccaagataccccagacgttcatcacatcaatgaaatccaagcagtgtccgatgtgtca
ctaatcatgcaagggcttaccccttctaacgaggaatactatcctacagttgttatcaat
accctactacacaatatcctaagtgagagttcccttgcccaatatcactccgccgtcatt
gatgctatcgtcacgatctttaagactttgggcctgaaatgcgttcctttcttgggacaa
ataatcccagctttcatttcggtgatcagagatacgccggtcagccgcctggatacctac
ttcaaccagcttgcaatattggttacaattgtcagacaacatattcgcgcatatctgcca
gagattattgttgttatccgcgaatattgggatgcgtcctatcaggtccaggcgacaata
ctgtctcttgtggaagcaatatccaagtctctggagggagagttcaagaaatatctagcc
ggattgatccccctgatgctagaaacaatcgaaaaggacagtagtccacggcgccagcca
tcagagagggttttgcatgcatttctcgtgtatggatccagcgcagaggaatatatgcac
agaattgtcccggcgattgttagattatttgataaacagcaggctccccaaaacatcagg
aagtcggccatcgaaaccctggcgaaactatctcgccaagtcaatgtgtctgactttgca
tcccttatgatccatccattggcaagggcaatcggctcaagtgaccgcactttgagacaa
tctgctttagattgcgtttgcaccctaatttttcagataggtcaggactttacgaattac
atccagttgatcaacaaggtactgtatccttttcgcagtttacaatttctagctactaac
gttcagcaggtgctcaaaaataatcaaattcaccaccacaactaccagatcctcgtatcg
aagctccagaaaggcgaacccctaccccaggacctgaatcctgacgagcaatacggttct
tttggtgacgaccaatcctttggagaggttggtcaaagaaagatccttgtaaaccagcag
catctcaagaatgcgtgggatgcaactcaaaaatcaactcgagaagactggcaagagtgg
atgagacgtttcagcgtagagcttcttaaagaatccccgtctcacgcccttcgggcttgc
gccagcttggcgggtatttaccaaccattggcaaaggatctgttcaatgccgcatttgtg
tcatgttggactgagctttaccatacttatcaagaagaactagttcactcgattgacctt
gcccttacggctcgaaatataccgccggaaattcttcagattcttcttaatttagcagag
ttcatggaacatgacgacaaagcacttcctattgatatccgcactcttgggaagtatgca
ggcaaatgtcacgcttttgcgaaggccttgcattataaagaacttgaatttgagcaagac
caaaactccggcgctgttgaagctttgattagtatcaataatcagcttcagcagttcgat
gcggcgattgggattctccgcaaagcgcaagcatatcgagacgtggagctaaaggagacg
tggttcgtaaagcttcaacgttgggaggaagctttagccgcgtataagcgacgtgaattg
attgatcctgattcttttgaagtcaccatgggaaagatgcgctgcttgcatgctcttggg
gaatggaagatgctttcggatttggctcaagaaaaatggaatcaagcgaccaacgaccac
cggatagctatcgcgcctcttgccgcagctgctgcttggggccgtgggcaatgggaactc
atggattcatacatcggagtaatgaaggaacagtcgcctgatcgatcgttctttggtgca
attctttccttgcatcgaaatcagttcaaagaagcggcggaatatattgagaaagctcgc
aacggtcttgatacggagctatctgcactgctaggtgaatcttataatcgcgcttacaac
gtggtcgtccgtgtccagatgctcgctgagctcgaagaaatcattacttataagcagagt
gctggtgatcctgagaagcaagaggccatgagacaaacatggaataaacggctcctaggt
tgtcaacagaacgttgaagtatggcaacgaatgcttaaagtcagagcgcttgttatttca
ccaagggaaaatttggatatgtggatcaagtttgccaatctctgtcgaaaatcgaatcga
atgggacttgcagaacgctctctcgcgtccctcgaagccgttgaatcttccgagtttgga
attccaccagaggtgacttatgctcgccttaaatttgactgggccgcaggccgccagcaa
gaggccctccaagcactcaaagactttactgcctctttgactgaagaatatgggaaatat
aattccctagttagtgccgcacggggccagcagcagcaggctgcagaaaacaaccatatg
actaacgggcagacggaacaaagagaagcggagatagctgcaatccgtcaacaccttggc
gaccttggcaaattccggcggcttcttgcaaagagccatctcaaacaaggcgaatggcag
acagccttacaaagaggggattggagatccgagaatgtctgcgatgtgctgaatgcttat
tccgccgccacgcattataatcgcgaatcctacaaggcctggcatgcttgggcgctcgca
aattttgaggtgctgaacgccttgagtcctcagtccaacaacgaaacagtatcgatacct
catcacattattagcgagcatgtagttcctgctatccaagggttctttcggtcgatcgca
ctttcatcatcaagcgccctccaagacactttgagacttctcacactctggttcacacat
ggtggtgacgcagacgtaaactccgttgtgactgatggcttcgccactgttagcattgat
acgtggcttgaagtgactccccaacttatcgcacgcatcaaccaacccaatcctcgggtt
cgcgctgcagtccaccgcctcctcgcggatctggggaaggctcatccacaagctctcgta
tatcccttaactgtggccacgaaatccaatgtggttcgccgttcgcaatccgcgatccac
atcatggatagcatgcgtcaacacagtcccaggctcgtcgaacaggccgaagttgtcagc
catgagctggttagggttgccgtcctttggcatgaactttggtatgatggtttggaagaa
gcatcccgactgtattttgcaaaccacaacgttgaaggaatgttcgcgaccctggcgcca
ctacatgacatgctagacaaaggcgctgaaactctgagagaggtgtccttcgctcaggct
ttcggccgtgacctagccgaagccagacatttctgtcttctttaccgtgaaacacaggaa
attggagacctcaaccaggcatgggatctgtactacactgtgtttaagaagattgaccgg
caggtccggcatatgaggacccttgatttgaaatacgtttcgcctaagctaaaggatgct
gtcgacttggatctggccataccaggcacttatcaaagcggaaaacctgtgattcgaatc
ctgagctttgatcctgtattaactctagttcaaacaaagaaaaagccgcgaaagatgatt
gttaaaggcagcgatggcaactcgtatatgtacgccctaaagggtcacgaagatatccgc
caagacgagagagtcatgcaactgtttgggcttgtcaatactctcttagaaaaagacagt
gaatgtttcaaacgtcacttgactattcaacgcttccctgccatccccctatcccaaaac
tctggtttgataggttgggtaacaaatactgacacactacatgccctgatcaaagagtat
cgggaaagccggcgcattctccttaacatcgagcaccgcataatgttgcaaatggcacca
gactacgagagtttaactcttatgcaaaaggtcgaagtatttggttacgctatggataac
acgaccggcaaagacctttatcgggttctttggcttaagagtaaaagctccgaagcctgg
cttgaacggcggaccaactacactcgctcgctcggcgttatgtcaatggtcggatatatc
ctcggtttgggtgatcgacacccatccaatcttttgttggatcggatcacgggcaagatc
gttcacatcgattttggtgactgctttgaggttgctatgcaccgcgaaaagtaccctgaa
agggttccattccgacttactcgtatgctcacctttgccatggaagtcagcaacattgag
ggaagctaccatatcacctgtgaagccgtgatgcgggttcttcgagagaataaagagtct
ttaatggcagtgttggaagcttttatccatgacccattgatcaattggcgactgggagcc
cgcgaatctcccgcacagccatctttcgctgaccgtcgccaatcaggtgaactcgatctc
gatcatccactacagcccggtaactttacacgccgccgtccctcgattctagacggtggc
attctggacgctcaacagggtattcccaacgaagccagagaagtgcaaaatgcccgagct
ctacaagtgcttggcagagttcgggaaaaactcactggtcgggactttaaaccacatgaa
gaacttaatgttagtgaccaggtggacaaacttcttgttcaggccacaagcgttgagaac
ttgtgccagcattacattgggtggtgcagtttttggtga

DBGET integrated database retrieval system