KEGG   Coccidioides immitis: CIMG_04365Help
Entry
CIMG_04365        CDS       T01114                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase tor2
  KO
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cim  Coccidioides immitis
Brite
KEGG Orthology (KO) [BR:cim00001]
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    CIMG_04365
Protein kinases [BR:cim01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   CIMG_04365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2396 aa AA seqDB search
MSQSSSATDALPKLFLELKSKNEETRLRAATELYDNVVAASRELPQDKFLEYYNTVSQRI
AQLVVTGGDANEKVAGLLALDRLIDFDGVDAALKTTRFSGYLRSALRSNDNAVLLYAARS
LGRLAKPGGALTAELVESEIQSALEWLQSERQENRRFAAVLVIRELAKGSPTLIYGFVAQ
ILELIWVAIRDPKVLIRETSADAISECFEIISARDSQVRHQWFAGIYDETLLGLRSTNVD
WIHGSLLALRELLLKGAMFMNEHYRNACEIVLRLKDHRDPKIRTQVVATIPVLASYAPLD
FTNTYLHRFMIYLQAQLKREKERNAAFIAIGKIASAVGNAIGQFLDGIIVYIREGLTLKA
RNRAAVNEAPMLECLSMLSMAVGQTLSKYMESLLDPIFACGLSKALTQALVDMAHYIPPI
RATVQEKLLDMLSLVLCGRPFQPLGCPDNRAPPMPSFVKESAPPPQEVTDSEITLALLTL
GSFDFSGHILNEFVRDVAIKYVDNDNSEIRKASALTCCQLFVHDPILNQTSSHSLQVVSQ
VIDKLLSVGVGDPEPEIRCTVLQSLDRKFDRHLAKPENVRCLFLAVNDEVFSVREAAISI
IGRLSNVNPAYVFPPLRKLLVNLLTGLSFATTSRQKEESAQLISLFVTNATKLVRSYVDP
MVTTLLPKTTDLNAAVSATTIKAIGEIATIGGEGMKQYLAQIMPIILEALQDLSSPSKRE
AALRTLGQLASNAGYVIEPYKEYPQLLAVLINIIKTEQAGSLRKETIKLIGTLGALDPYK
YQQISQDTPDVHHINEIQAVSDVSLIMQGLTPSNEEYYPTVVINTLLHNILSESSLAQYH
SAVIDAIVTIFKTLGLKCVPFLGQIIPAFISVIRDTPVSRLDTYFNQLAILVTIVRQHIR
AYLPEIIVVIREYWDASYQVQATILSLVEAISKSLEGEFKKYLAGLIPLMLETIEKDSSP
RRQPSERVLHAFLVYGSSAEEYMHRIVPAIVRLFDKQQAPQNIRKSAIETLAKLSRQVNV
SDFASLMIHPLARAIGSSDRTLRQSALDCVCTLIFQIGQDFTNYIQLINKVLYPFRSLQF
LATNVQQVLKNNQIHHHNYQILVSKLQKGEPLPQDLNPDEQYGSFGDDQSFGEVGQRKIL
VNQQHLKNAWDATQKSTREDWQEWMRRFSVELLKESPSHALRACASLAGIYQPLAKDLFN
AAFVSCWTELYHTYQEELVHSIDLALTARNIPPEILQILLNLAEFMEHDDKALPIDIRTL
GKYAGKCHAFAKALHYKELEFEQDQNSGAVEALISINNQLQQFDAAIGILRKAQAYRDVE
LKETWFVKLQRWEEALAAYKRRELIDPDSFEVTMGKMRCLHALGEWKMLSDLAQEKWNQA
TNDHRIAIAPLAAAAAWGRGQWELMDSYIGVMKEQSPDRSFFGAILSLHRNQFKEAAEYI
EKARNGLDTELSALLGESYNRAYNVVVRVQMLAELEEIITYKQSAGDPEKQEAMRQTWNK
RLLGCQQNVEVWQRMLKVRALVISPRENLDMWIKFANLCRKSNRMGLAERSLASLEAVES
SEFGIPPEVTYARLKFDWAAGRQQEALQALKDFTASLTEEYGKYNSLVSAARGQQQQAAE
NNHMTNGQTEQREAEIAAIRQHLGDLGKFRRLLAKSHLKQGEWQTALQRGDWRSENVCDV
LNAYSAATHYNRESYKAWHAWALANFEVLNALSPQSNNETVSIPHHIISEHVVPAIQGFF
RSIALSSSSALQDTLRLLTLWFTHGGDADVNSVVTDGFATVSIDTWLEVTPQLIARINQP
NPRVRAAVHRLLADLGKAHPQALVYPLTVATKSNVVRRSQSAIHIMDSMRQHSPRLVEQA
EVVSHELVRVAVLWHELWYDGLEEASRLYFANHNVEGMFATLAPLHDMLDKGAETLREVS
FAQAFGRDLAEARHFCLLYRETQEIGDLNQAWDLYYTVFKKIDRQVRHMRTLDLKYVSPK
LKDAVDLDLAIPGTYQSGKPVIRILSFDPVLTLVQTKKKPRKMIVKGSDGNSYMYALKGH
EDIRQDERVMQLFGLVNTLLEKDSECFKRHLTIQRFPAIPLSQNSGLIGWVTNTDTLHAL
IKEYRESRRILLNIEHRIMLQMAPDYESLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKS
SEAWLERRTNYTRSLGVMSMVGYILGLGDRHPSNLLLDRITGKIVHIDFGDCFEVAMHRE
KYPERVPFRLTRMLTFAMEVSNIEGSYHITCEAVMRVLRENKESLMAVLEAFIHDPLINW
RLGARESPAQPSFADRRQSGELDLDHPLQPGNFTRRRPSILDGGILDAQQGIPNEAREVQ
NARALQVLGRVREKLTGRDFKPHEELNVSDQVDKLLVQATSVENLCQHYIGWCSFW
NT seq 7191 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcatcatctgcaaccgatgcgctcccgaagctcttcctagagctcaagtcg
aaaaacgaggaaacaaggctgcgagcagcgactgaactatacgataatgtagtagcagcg
tcgagagagctcccgcaggataaattcctcgagtattataacacggtcagccagcgaata
gctcagctcgtggttacagggggcgacgcgaatgagaaggtggccggacttcttgcgctt
gataggttgatcgatttcgacggtgttgatgctgccctaaagacaacgagattctctggc
tacttgcgtagcgcattgaggagtaacgataatgcagtgttgctttatgcagccaggtcg
ctggggcgcctagcaaaacctggcggtgcattaactgcagaattggtggaaagtgagata
caatcggcactagaatggttgcaatcggaaagacaagagaatcgacgttttgctgccgtg
ttggtcatcagggaactcgccaaaggctccccaactctcatctacggattcgttgcgcaa
atacttgaacttatctgggttgccatccgtgatccgaaagtgcttatccgagagacgtct
gctgatgctatcagcgaatgctttgaaattatttcggctcgagatagccaggttcgccat
cagtggtttgcgggaatctacgatgagacgctacttggtctaagatcaacgaacgtggat
tggatccatggctctctccttgcgcttagagaattgctccttaaaggggccatgtttatg
aacgagcactaccgcaacgcttgtgagatagttctccggctgaaagaccaccgagacccc
aaaatccggacccaggtggtcgctacaatccccgtgcttgcatcatatgctccattagac
tttacgaatacttatctccatagattcatgatatacctacaggcgcagctaaagcgagag
aaagagcggaatgccgcgttcatcgctatcggtaagattgctagtgctgtggggaacgcg
attggtcagttcctcgatggcatcattgtgtatattcgtgagggcttgactctgaaagca
cgcaatcgtgctgcagtgaacgaagctccaatgctagaatgcctcagcatgctatctatg
gccgtggggcaaactctcagcaagtatatggaatctcttctcgaccctatctttgcctgt
ggcctgagtaaagctctcactcaagctctagtcgatatggcacattatattccgcctatc
agagccacggtccaagaaaagctgctcgacatgttaagtttagttttgtgtggaaggccc
ttccaaccccttggctgccctgacaatcgcgccccgcctatgccgtcttttgtgaaagaa
tctgcaccgccaccccaagaagtcactgacagcgagattacccttgccctgctaacacta
gggagcttcgacttctctggccatatattgaacgagtttgtccgcgatgtggctataaaa
tacgtggacaatgataactccgagatccgcaaagcatccgccttgacttgttgtcaactg
tttgtccatgaccctattctcaaccagacaagcagccattctctccaggttgtcagccag
gttatcgacaagctcttatctgtaggagttggtgaccctgaacccgaaatccgctgcacg
gtattacaatcactggatcgaaaatttgatcgtcatttagccaaaccggaaaatgttcgc
tgcctttttctcgctgtcaatgatgaagtgttctccgttcgagaagcagcaattagtata
attggtcgtttatcaaacgtcaatcctgcttatgttttcccaccgttgcgaaagctgctt
gtcaatcttctaacggggcttagttttgcaacgacgtcccgtcaaaaggaagaaagtgct
cagttgattagtttgtttgtcacaaatgcaaccaaattggttcgctcctacgttgaccca
atggtcacgactctattgccgaagacaacagacctcaatgccgcagtgtcagcgactacc
ataaaagcaatcggagaaatcgcaaccattggcggtgagggcatgaagcaatacctggct
cagattatgcctattatattggaagctttacaagatctgtcctcgccctcaaaacgagag
gccgctttgcgcactcttggacagcttgcgagcaatgccggctacgttatcgagccctat
aaggaatacccacaactccttgctgtcctcattaacatcatcaaaacggaacaagccggg
tcccttcggaaagaaactatcaagctcattggcaccctaggagctctcgacccctacaaa
tatcagcaaataagccaagataccccagacgttcatcacatcaatgaaatccaagcagtg
tccgatgtgtcactaatcatgcaagggcttaccccttctaacgaggaatactatcctaca
gttgttatcaataccctactacacaatatcctaagtgagagttcccttgcccaatatcac
tccgccgtcattgatgctatcgtcacgatctttaagactttgggcctgaaatgcgttcct
ttcttgggacaaataatcccagctttcatttcggtgatcagagatacgccggtcagccgc
ctggatacctacttcaaccagcttgcaatattggttacaattgtcagacaacatattcgc
gcatatctgccagagattattgttgttatccgcgaatattgggatgcgtcctatcaggtc
caggcgacaatactgtctcttgtggaagcaatatccaagtctctggagggagagttcaag
aaatatctagccggattgatccccctgatgctagaaacaatcgaaaaggacagtagtcca
cggcgccagccatcagagagggttttgcatgcatttctcgtgtatggatccagcgcagag
gaatatatgcacagaattgtcccggcgattgttagattatttgataaacagcaggctccc
caaaacatcaggaagtcggccatcgaaaccctggcgaaactatctcgccaagtcaatgtg
tctgactttgcatcccttatgatccatccattggcaagggcaatcggctcaagtgaccgc
actttgagacaatctgctttagattgcgtttgcaccctaatttttcagataggtcaggac
tttacgaattacatccagttgatcaacaaggtactgtatccttttcgcagtttacaattt
ctagctactaacgttcagcaggtgctcaaaaataatcaaattcaccaccacaactaccag
atcctcgtatcgaagctccagaaaggcgaacccctaccccaggacctgaatcctgacgag
caatacggttcttttggtgacgaccaatcctttggagaggttggtcaaagaaagatcctt
gtaaaccagcagcatctcaagaatgcgtgggatgcaactcaaaaatcaactcgagaagac
tggcaagagtggatgagacgtttcagcgtagagcttcttaaagaatccccgtctcacgcc
cttcgggcttgcgccagcttggcgggtatttaccaaccattggcaaaggatctgttcaat
gccgcatttgtgtcatgttggactgagctttaccatacttatcaagaagaactagttcac
tcgattgaccttgcccttacggctcgaaatataccgccggaaattcttcagattcttctt
aatttagcagagttcatggaacatgacgacaaagcacttcctattgatatccgcactctt
gggaagtatgcaggcaaatgtcacgcttttgcgaaggccttgcattataaagaacttgaa
tttgagcaagaccaaaactccggcgctgttgaagctttgattagtatcaataatcagctt
cagcagttcgatgcggcgattgggattctccgcaaagcgcaagcatatcgagacgtggag
ctaaaggagacgtggttcgtaaagcttcaacgttgggaggaagctttagccgcgtataag
cgacgtgaattgattgatcctgattcttttgaagtcaccatgggaaagatgcgctgcttg
catgctcttggggaatggaagatgctttcggatttggctcaagaaaaatggaatcaagcg
accaacgaccaccggatagctatcgcgcctcttgccgcagctgctgcttggggccgtggg
caatgggaactcatggattcatacatcggagtaatgaaggaacagtcgcctgatcgatcg
ttctttggtgcaattctttccttgcatcgaaatcagttcaaagaagcggcggaatatatt
gagaaagctcgcaacggtcttgatacggagctatctgcactgctaggtgaatcttataat
cgcgcttacaacgtggtcgtccgtgtccagatgctcgctgagctcgaagaaatcattact
tataagcagagtgctggtgatcctgagaagcaagaggccatgagacaaacatggaataaa
cggctcctaggttgtcaacagaacgttgaagtatggcaacgaatgcttaaagtcagagcg
cttgttatttcaccaagggaaaatttggatatgtggatcaagtttgccaatctctgtcga
aaatcgaatcgaatgggacttgcagaacgctctctcgcgtccctcgaagccgttgaatct
tccgagtttggaattccaccagaggtgacttatgctcgccttaaatttgactgggccgca
ggccgccagcaagaggccctccaagcactcaaagactttactgcctctttgactgaagaa
tatgggaaatataattccctagttagtgccgcacggggccagcagcagcaggctgcagaa
aacaaccatatgactaacgggcagacggaacaaagagaagcggagatagctgcaatccgt
caacaccttggcgaccttggcaaattccggcggcttcttgcaaagagccatctcaaacaa
ggcgaatggcagacagccttacaaagaggggattggagatccgagaatgtctgcgatgtg
ctgaatgcttattccgccgccacgcattataatcgcgaatcctacaaggcctggcatgct
tgggcgctcgcaaattttgaggtgctgaacgccttgagtcctcagtccaacaacgaaaca
gtatcgatacctcatcacattattagcgagcatgtagttcctgctatccaagggttcttt
cggtcgatcgcactttcatcatcaagcgccctccaagacactttgagacttctcacactc
tggttcacacatggtggtgacgcagacgtaaactccgttgtgactgatggcttcgccact
gttagcattgatacgtggcttgaagtgactccccaacttatcgcacgcatcaaccaaccc
aatcctcgggttcgcgctgcagtccaccgcctcctcgcggatctggggaaggctcatcca
caagctctcgtatatcccttaactgtggccacgaaatccaatgtggttcgccgttcgcaa
tccgcgatccacatcatggatagcatgcgtcaacacagtcccaggctcgtcgaacaggcc
gaagttgtcagccatgagctggttagggttgccgtcctttggcatgaactttggtatgat
ggtttggaagaagcatcccgactgtattttgcaaaccacaacgttgaaggaatgttcgcg
accctggcgccactacatgacatgctagacaaaggcgctgaaactctgagagaggtgtcc
ttcgctcaggctttcggccgtgacctagccgaagccagacatttctgtcttctttaccgt
gaaacacaggaaattggagacctcaaccaggcatgggatctgtactacactgtgtttaag
aagattgaccggcaggtccggcatatgaggacccttgatttgaaatacgtttcgcctaag
ctaaaggatgctgtcgacttggatctggccataccaggcacttatcaaagcggaaaacct
gtgattcgaatcctgagctttgatcctgtattaactctagttcaaacaaagaaaaagccg
cgaaagatgattgttaaaggcagcgatggcaactcgtatatgtacgccctaaagggtcac
gaagatatccgccaagacgagagagtcatgcaactgtttgggcttgtcaatactctctta
gaaaaagacagtgaatgtttcaaacgtcacttgactattcaacgcttccctgccatcccc
ctatcccaaaactctggtttgataggttgggtaacaaatactgacacactacatgccctg
atcaaagagtatcgggaaagccggcgcattctccttaacatcgagcaccgcataatgttg
caaatggcaccagactacgagagtttaactcttatgcaaaaggtcgaagtatttggttac
gctatggataacacgaccggcaaagacctttatcgggttctttggcttaagagtaaaagc
tccgaagcctggcttgaacggcggaccaactacactcgctcgctcggcgttatgtcaatg
gtcggatatatcctcggtttgggtgatcgacacccatccaatcttttgttggatcggatc
acgggcaagatcgttcacatcgattttggtgactgctttgaggttgctatgcaccgcgaa
aagtaccctgaaagggttccattccgacttactcgtatgctcacctttgccatggaagtc
agcaacattgagggaagctaccatatcacctgtgaagccgtgatgcgggttcttcgagag
aataaagagtctttaatggcagtgttggaagcttttatccatgacccattgatcaattgg
cgactgggagcccgcgaatctcccgcacagccatctttcgctgaccgtcgccaatcaggt
gaactcgatctcgatcatccactacagcccggtaactttacacgccgccgtccctcgatt
ctagacggtggcattctggacgctcaacagggtattcccaacgaagccagagaagtgcaa
aatgcccgagctctacaagtgcttggcagagttcgggaaaaactcactggtcgggacttt
aaaccacatgaagaacttaatgttagtgaccaggtggacaaacttcttgttcaggccaca
agcgttgagaacttgtgccagcattacattgggtggtgcagtttttggtga

DBGET integrated database retrieval system