KEGG   Coccidioides immitis: CIMG_04407Help
Entry
CIMG_04407        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cim  Coccidioides immitis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CIMG_04407
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CIMG_04407
Enzymes [BR:cim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CIMG_04407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 913 aa AA seqDB search
MGDIGYRQMGQLFVMGFDGTSVDPQIRSLIEDYRLAAEETTKLVLELQTIARDAGHPAPL
MIGLDQENGGVNSLFDEIYIRQFPSAMGIAATGSKSLAREVAKATAQELSAVGVNWILGP
VLDVLNNARSQPLGVRSIGDDAQEVSAYGVEFMKGYQEAGLVTCGKHFPSYGNLEVLGNQ
TDVPVITDTLEQLSMSALVPFRNAIAQGIDSMMVGGCAMSSAGVNVMHACLSEQVVDDLL
RKDLNFNGVVVSECLEMEALSFNIGVGGGTVMAMKAGCDLILLCRSFSVQQEAINGLRLG
VENGIINKERIRQSVQRVLDMKARCTSWEKALNPAGISLLSQMQPSHTSLSTRAYNSSIT
IVRDKNNLLPLTSVLEPDEELLLLTPLVKPLPASAVSLSITESSRETVLSTDTVSWERSA
SVMSGESVFREFGRSLARHRNGRVLHTSYTANGVRPVHENLINRASGVIVVTADSNRNLY
QYGFTKHVAMICNAQFAANGDRRSKPLVVVAVSSPYDFATDQSIGTYVCTYDFTETALQA
LVKVLYGDLTATGVLPGTLSRSQKLHQSRQHWLVENWNEDRDANALDELLTAIREDSTHN
QRSALAGVTSNTFLLRNSDVEEAHFVVRNSSTQALYGFCSTYFFKSTGTAVIGALIVDPG
RRKLSIGNSLHNRAIRSLMQRQGVRRFQLGSRLPGVYLGIPTGNPVERKRLRQWFASLGW
NTSLSRPVCTMILPNLGEWTPPEGLTRTLKSAEVSYDLVYGLDYAEAILDHVKTNSRQGV
MEIYKMALSGSSANGIIRAKRNGDDAILGTVVVYTSESTLAEFVPTVKEARPMGGGISSA
VISPSAGEYSTIVQGLILLGIKQLRSQGASAVVLDCVDGDGNFDGLSAMGFSTLHSFEEV
TCDAATWNMLTSS
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgggagacattggctacaggcagatgggccagctctttgtcatgggctttgatggaact
agcgtcgatccccagatccggtcacttatcgaggactatcggcttgcggcagaagaaacc
acaaagctcgtgttagagcttcagactattgcccgggatgctggtcaccctgctccactc
atgattggcctcgatcaggagaatggaggcgtcaacagtcttttcgatgagatctatatc
cgccaatttccgagcgctatgggaatcgcggctactggatcgaagtctctagcaagggaa
gttgcgaaagccactgctcaagagctcagtgctgtcggagtcaattggatccttggtccg
gtcctggatgtcttgaacaacgcaagaagtcagcctttgggagtcagaagtattggggat
gatgctcaagaggtatcagcctacggtgttgagttcatgaagggctatcaggaagcgggc
ttggttacttgtgggaagcactttccatcttatggaaaccttgaagtgctaggaaaccaa
acggacgtccctgttatcacagacacgcttgagcagctcagcatgagtgcccttgtccct
tttcgaaacgcaattgcacaggggattgattctatgatggttggtggttgcgcgatgtca
tcggctggtgtgaacgtgatgcacgcttgcttgtccgagcaagttgtcgatgacttgctt
cggaaggacctcaacttcaacggcgtcgtggtctctgaatgcctggaaatggaagcgctc
agtttcaacattggagtaggaggaggaacggtaatggcgatgaaagctggctgcgacttg
atactcctttgccggtcattctcagttcagcaagaagcaatcaatggcttgagacttggg
gttgagaacggtatcatcaataaagaacggatcaggcaatcagtgcagagagttcttgac
atgaaagcccgctgtacatcgtgggagaaggcattaaaccctgccggcatcagtcttctc
tcccaaatgcaaccatcccacaccagtctatccaccagggcctataatagctccattacc
atcgtcagagacaaaaacaacctccttccactcaccagcgtcctggaacccgacgaagag
cttctccttctcacacctttagtcaaacctctgcccgcatctgctgtgtccctctcaatc
actgaaagtagcagagaaacggttctttccacagatacagtctcctgggagcgcagtgcg
tctgtcatgagcggggagagcgtttttcgcgaatttgggcgctcgctagctcgacataga
aacggtcgcgttctccatacatcatataccgccaatggagttcgcccagtccacgaaaat
cttattaatcgcgcaagcggtgtcatcgttgtcaccgctgactcgaaccgaaacctctat
cagtatggcttcacaaaacatgttgccatgatatgcaatgcacagtttgcagcaaatgga
gataggcgttccaaaccacttgtggtagtggcagtgagctcaccttatgactttgccaca
gatcagtccattggaacatatgtgtgcacatacgattttacagaaacagctcttcaggcg
ttggtcaaggttttatacggagatttgacggctaccggcgttcttcccggcaccttgagc
cgcagccagaagcttcaccagtcaaggcagcattggcttgtagaaaattggaatgaggat
cgcgatgcgaacgcattggacgaactgctcaccgctatccgcgaagacagcacgcacaac
caacgatcggctcttgcaggtgttacatccaatacattcttgttacgaaattctgatgtt
gaagaggcgcattttgttgtcaggaatagcagcactcaggcgctgtatgggttctgctcg
acatacttcttcaagtccactgggactgctgtaattggcgccctgatcgtcgatccgggg
aggcgaaagctgtcgattggaaactctttacacaatcgtgcaattcgatcattgatgcag
agacaaggcgtgaggcgattccagttgggctcacggctcccaggggtatatcttggtatt
ccgacaggaaacccagtagagagaaaacgtctccgtcagtggttcgccagtctgggttgg
aatacgtctttatccagacctgtttgcacaatgatcctcccaaatctgggggagtggacg
ccaccagaaggccttactcgaactttgaagagtgcggaagtgagttacgatctggtttat
ggcctggactatgcagaagcaatcctcgatcacgttaagacgaattcacggcagggagtt
atggagatatacaaaatggcgttaagtgggtcttctgcgaatggaatcattcgcgctaaa
cggaatggcgatgacgctatcttggggactgttgttgtgtacaccagtgaatcgacgctg
gccgaattcgttcccacagtgaaggaggcgcgtcctatgggtggaggaatctcctcagcg
gtcatctccccttctgccggggagtattcgaccatcgttcaaggcctgattttactggga
atcaagcaattacgtagccagggggccagtgcggtggttctggattgtgtggatggggac
ggcaatttcgatggtctgtcggccatggggttctctacgctccacagcttcgaggaggtg
acctgtgatgcggccacctggaacatgttgacttcgtcgtga

DBGET integrated database retrieval system