KEGG   Coccidioides immitis: CIMG_04465Help
Entry
CIMG_04465        CDS       T01114                                 

Definition
similar to UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cim  Coccidioides immitis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CIMG_04465
   00052 Galactose metabolism
    CIMG_04465
   00500 Starch and sucrose metabolism
    CIMG_04465
   00520 Amino sugar and nucleotide sugar metabolism
    CIMG_04465
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CIMG_04465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 523 aa AA seqDB search
MASRAIPSHLRAPNTESRSAEERSFVRHHGKSQSHMAFEHASTNVAASQMRNALNALSDT
VKDPSEKKRFEAEMDNFFSLFRRFLNDKAKGNVLSWDRIAPPQPNQVVEYSELSNSASVD
YLKKLAVIKLNGGLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEYLNRTYNVNVPLVLMN
SFNTDDDTQSIIKKYEGHNIDIITFNQSRYPRVLKDSLLPAPKDYSSPITDWYPPGHGDV
FESLYNSGTLDKLIERGVEIVFLSNADNLGAVVDMRILEHMVTNNSEYIMELTDKTKADV
KGGTIIDYEGKARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWLNLRAIKRVVEESALEM
EIIPNEKSIPADKKGEADISIIQLETAVGAAIRFFKGAHGVNVPRRRFLPVKTCSDLMLV
KSDLYTLQHGQLVIDPNRFGGAPLIKLGTDFKKVSDFQKRIPSIPRILELDHLTISGAVN
LGRGVTLKGTVIIVATEGSTIDIPPGSILENVVVQGSLRILEH
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagggcaattccatcgcaccttcgcgctccaaacaccgagtctcgctccgcc
gaggaaagaagcttcgtcaggcatcatggcaagtctcagtcacacatggccttcgagcat
gcctccaccaacgtcgcagcttcgcagatgcgcaacgccctcaatgccctctcggacacc
gtcaaagaccccagtgaaaagaagcgtttcgaggctgagatggacaacttcttctccctc
ttccgcagattcttgaacgacaaggccaagggcaatgttctctcctgggatcgcattgcc
ccgcctcagccaaaccaggtcgtcgagtacagcgagctcagcaactccgcttcggtcgac
tacctcaagaaactggccgtcatcaagttgaatggtggcctcggtacttctatgggatgc
gttggtccaaagtccgtcattgaagtgagagaaggcatgtccttcctcgacctctccgtc
aggcagatcgagtacctcaaccgtacttacaacgtcaacgttcctctcgtcctgatgaac
tccttcaacaccgacgacgacacccagtcaatcatcaagaaatacgagggtcacaacatc
gatatcatcacattcaatcaatcacgctacccgcgtgtcctcaaggactctcttctccca
gcacccaaggactactcctctccgatcacggattggtatccccccggccacggagacgtc
tttgagtctctctacaactctgggacccttgacaagttgatcgagcgtggtgtcgagatt
gtcttcttgtccaatgctgacaacctcggagcagtcgtcgatatgcgcattttggagcac
atggtgacgaataactctgaatacattatggaactgaccgacaagaccaaggcagatgtc
aagggtggcaccatcatcgactacgagggcaaggctcgcctacttgaaatcgcccaggtt
cccaaggagcatgtgaacgagttcaagtcgattaagaaattcaagtactttaataccaat
aatatctggctgaacctccgcgccatcaaacgcgtggtggaggagagtgctcttgaaatg
gagatcattccaaacgaaaagtccatccctgcggacaagaagggagaagcagatatttcc
atcatccagctggagactgctgtcggtgcggcaatccgtttcttcaagggtgctcatggt
gtgaacgtccctcgtcgccgtttcttgccagtgaagacttgctccgatctcatgctggtc
aagtctgacctgtatacacttcagcatggccagctggtcattgaccctaaccgattcggc
ggtgccccactcatcaagttgggcaccgacttcaagaaagtttcagatttccagaagcgc
atcccgagtattcctcgcatcctggaacttgaccatcttactatcagtggagccgtcaac
ctgggacgcggcgttactctcaagggcacggtcattattgtagctacggagggaagcacg
atcgatatcccaccagggtcgattctcgagaatgttgtcgtgcagggaagtttgcgcatc
ctggagcactag

DBGET integrated database retrieval system