KEGG   Coccidioides immitis: CIMG_04476Help
Entry
CIMG_04476        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CIMG_04476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MARSTIVQEYGAPPIPNQTLALDAKTANEVEHDIVKRPKGYRVSWHANPAVEPHHFGSNH
PMKPWRLTLTKQLVLAYGMHHAMDLYLSRSATYEEMAEFHSTDYLEFLTQVMPADMESTA
QVETLARFNFGDDCPVFDGLYNYCSLYAGATLDAARKLCNNQSEIAINWSGGLHHAKKSE
ASGFCYVNDIVLGILQLLRIHPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDKENF
FPGTGPLDSTGPSHPLNPGAHHSLNVPLNDGIEDNDYIALFKAIIGPCIRTYQPGAIVLQ
CGADSLGCDRLGCFNLNIRAHGACVAYTKTFGLPTLVVGGGGYTPRNVSRLWAYETAICL
EAESDLNPVLPDSLKFRNHFRPDCTLFPPLSEMRKVENKNSKAYLDSLVQSTMEQLRYIK
GAPSVQMSVIPPDILGLREEIEKELEEEKLLGEEEKEDRDGAGVSTLGIGGSRPSRRKDQ
EKGLGVRGELYT
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcccgatccactattgtccaagaatacggcgcgccaccgattccaaatcagacattg
gcccttgacgccaaaactgcaaacgaagtcgaacatgacatcgtcaaacggcccaagggc
taccgtgtatcatggcacgctaatcctgctgttgaaccgcatcacttcggctctaatcac
cccatgaagccatggcgactcactctcacaaagcaactcgttttggcctacggcatgcac
cacgcgatggacttgtacctgtcccggtcggcgacgtacgaggaaatggcggagttccat
agtacggactacctcgagtttctcacccaagtgatgcctgcagacatggagtcaacggcc
caagtcgagaccctcgcccgtttcaactttggcgacgactgcccggtcttcgatggactc
tataactattgctcgctatacgccggtgcaaccctagatgcagcgcgtaaactttgcaat
aatcaatctgaaatcgctataaattggtctggtggcttgcaccacgctaagaagtcggaa
gccagtggtttctgctacgttaacgatatcgtgcttggaatccttcagttactccgaatc
cacccgcgggtgatgtatatcgacatcgatgtgcatcatggcgatggagttgaacaagcg
ttctggtctacagaccgtgtcctcacggtttctttccacaaatacgataaggaaaacttc
ttccccggcaccggacctttagacagcactggcccctcacatccgctcaaccccggcgct
catcactccctgaatgtccctttaaacgacggcatcgaagacaacgattacattgccctc
ttcaaagccattatcggaccctgcatccgcacctaccaacccggcgcaatcgtcctccaa
tgtggtgccgacagtcttggctgcgatcgcctcggttgcttcaaccttaacatccgtgca
cacggcgcctgcgtcgcatacaccaaaaccttcggtctacccaccctcgtcgtcggcgga
ggtggctacacccctcgcaacgtctcgcggctctgggcttacgaaacagccatctgcctc
gaagccgaaagcgacctcaatcccgttcttccggactccctaaagttccgcaatcacttc
cgtcccgattgcacattatttccgcctttgtcggaaatgcggaaagttgagaataaaaat
tctaaagcgtacctggactcgttggtgcagagtacaatggagcaattgagatatatcaaa
ggtgcgcccagtgtgcaaatgagtgtgattccaccagatatattaggcttgagggaggaa
atcgagaaggagcttgaagaggagaagttgttgggcgaagaagaaaaagaggatcgtgat
ggtgcgggtgtcagcacgctggggattggagggtcaagacctagcagaaggaaagatcaa
gagaaaggcttgggggttagaggagagctgtacacataa

DBGET integrated database retrieval system