KEGG   Coccidioides immitis: CIMG_04563Help
Entry
CIMG_04563        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cim  Coccidioides immitis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CIMG_04563
Enzymes [BR:cim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CIMG_04563
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIMG_04563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 606 aa AA seqDB search
MSRNDPLLVPSDHSPERSDAEEDALLTGQRTHRSERGRGPSFWREVGLFSWALIATAAVI
ILAVVYQHQQSTGRHEGSLAPGDKPAGKRNLIFMVSDGMGPTSLSMTRSFRQSRDGLPID
DILVLDKHHIGQSRTRSSSSLITDSAAGATAFSCAKKSYNGAISVLPDHSPCGTVLEAAK
AAGYMTGLVVTTRITDATPACFSSHANMRSYEDLIAEHQIGEYPLGRQVDLIIGGGRCHF
LPNTTSGSCRGDARDIVQLAKSKGFSYIDDREGFDGLKMGSAAQLPLLGLIAEKNVPFEI
DRRFQNDIYPSLEEMTRTALKALSDATRDSDKGFFIMIEGSRIDHAGHGNDPAAQVHEVL
AYDRAFAAVLEFLEKDSTPGVLVSTSDHETGGLSAARQLHESYPDYKWFPGVLENATHSS
EYLETKLYNYLDDEGKSVPKEEQRAYVRRQFVEKGLGIFDAKNSEIDQLLQAGDPVPAAY
VFADMISRRAQIGWSTHGHSAADVNIYASSPEDALDLVGNHENTEVGDFLAKYLDLDLDA
ITQKLKETQTSPKAATYDYAWMGEPLADDVVVDELDTYHGDFKKRSLSGRSVNYIGGGGC
GCGAVH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggaacgatcccttgctagtaccctccgaccactcgccggaacgaagcgatgcc
gaagaagatgccctcctcaccggtcagcggactcatcgaagcgagcgcggccgtggtcca
tcattctggcgtgaagttggattgttctcctgggctttaatagccactgcagccgttatc
atcctcgcagtcgtgtaccagcatcagcagtcgaccggtagacatgaaggaagcttggcc
cccggcgataagccggcaggaaaacggaatcttattttcatggtttctgatggaatgggc
cctacgagtttgtcgatgacacggagcttccggcaatcgcgggatggccttcccatcgac
gatattctcgttttggataagcatcatatcggacagtctcgaacaagatcatcgtctagc
ttgattacggactctgcggcgggcgcgacggcattttcttgtgcgaagaagagttataac
ggtgctatctctgtgctgcccgaccatagcccatgcgggaccgtcctagaggcagcgaag
gcggctgggtatatgacagggttggtggttacaacgagaattacagatgccacccccgcc
tgcttttcttcccatgccaacatgcgctcgtatgaggacttgattgcagagcaccaaatc
ggagaatacccgctgggacgccaggttgatcttatcattgggggaggcagatgccatttc
cttccaaacactacttctggcagctgtcgtggtgacgccagagatattgtgcagcttgcc
aaatctaaaggtttttcatatattgatgaccgtgaagggttcgatggacttaaaatgggc
agtgcggcccagcttccattacttggccttatcgcggaaaagaatgtgccattcgaaatt
gaccgtcgatttcaaaacgacatatatccttctctggaagaaatgactcgcacggccttg
aaagccttaagcgatgccacacgcgatagcgacaagggcttctttattatgattgaaggt
tcgcgtattgaccatgctggccatggcaatgatcctgccgcccaggtccatgaagtccta
gcttatgatagagcttttgctgctgtcctggaattccttgaaaaagactctacccccggt
gtgcttgttagcacatcggatcacgagaccggaggtctatcggcggcccggcagcttcat
gagtcgtatcctgactacaaatggttcccaggtgtccttgagaatgccacacattcctct
gagtacttagagaccaagctctataactaccttgatgacgaaggaaaatccgtgcccaag
gaggagcagcgtgcgtacgtacgtcgacaattcgtggagaagggacttggaatatttgat
gcgaaaaattccgaaatcgaccaactcctccaggccggcgacccggtgccggccgcgtat
gttttcgctgacatgatcagccgaagagcccagataggatggtcaactcatggacattcc
gctgcggatgtgaatatctacgcctcttccccagaagacgccttggatcttgtcggtaat
cacgaaaacaccgaagttggcgacttcttagctaaatatctcgacttggatcttgatgca
atcacccaaaaactcaaggagactcaaactagtccaaaagctgccacctacgattacgcc
tggatgggcgaaccattagctgatgatgtcgtcgtcgatgaactcgatacctaccatggc
gacttcaagaaacgtagtctctctgggagaagcgtcaattatatcggcggtggaggatgt
ggttgcggagcggtgcattga

DBGET integrated database retrieval system