KEGG   Coccidioides immitis: CIMG_04824Help
Entry
CIMG_04824        CDS       T01114                                 

Definition
(RefSeq) protein disulfide-isomerase
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
cim  Coccidioides immitis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CIMG_04824
Enzymes [BR:cim01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CIMG_04824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 527 aa AA seqDB search
MLKHSSFVVLLTALLGALPASAESLYTKKSPVLQVDATNYDRLIARSNHVSIVEFYAPWC
GHCQNLKPAYEKAAKSLEGLAKVAAVNCDDEANKSFCGIMRIQGFPTLRMVIPSDKPGKP
KHEDYKGPRTAKGIVDAVVEKIPNRVKRLTDKDIDDWLTNSNETAKAILFTEKGTTSALL
RALAIDFHGKIQIGQIRNKETSAVDMFGVTKFPTFVLLPGSDKPSVVYDGELKKKPMLEF
LSQVAEPNQDPPPLKKSGPQKPKKPTTTAGDTATNKPTESANDSTDPREPKKFTASERRS
QAEEPKVPQLRVLSTTTDLRTTCLSSKTGTCILAIVPVPSDPNLPPSMSALQALNSLSDI
ERKHALRQARLFPFYVAPDDIEEVPKLRDELGLKSDIVEIIAINGKRGWWRRYDSADGSK
YGVVDLEKWVDQVRMGEAEKHKIPEGALLSESKEEPKVEPEVTPEQEPEKEPEQEPEAPP
QDEPEQKTEKEPDHEPEATPSATPETEPQQETTESPKEPKTAVHEEL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaacatagctcatttgtcgtgctgctgactgcgctcttgggagctcttcctgcg
agtgcagagagcctgtatactaagaaatctccagttctccaggtcgatgcaactaactac
gaccgtctcattgctagatctaaccatgtttctatcgtagagttctatgcgccgtggtgt
ggccattgccagaacctcaaaccagcgtacgaaaaggcggcgaagagcttggagggattg
gctaaagttgccgctgttaattgcgacgatgaggcgaacaaaagcttctgtggcataatg
cgtatacagggattccctacgcttagaatggtgattccttccgacaagccaggaaaacca
aagcacgaagactacaaaggcccaagaaccgcgaaaggtatagtagacgctgtcgtggag
aaaattccaaaccgcgtaaagcgcctcaccgacaaggacatcgatgactggttgacgaac
tcaaacgagaccgcaaaggccattctcttcaccgagaaaggcaccaccagtgcactgtta
agagcattggccattgatttccatggcaaaattcaaatcggtcaaataaggaacaaggag
acttcggctgtggacatgtttggcgtcacaaagtttcccacctttgtcctcctccctgga
tcggacaagccgtcggttgtatatgatggagagttgaagaagaagcccatgctggagttc
ctgagccaagttgcggagccaaaccaagatccaccaccactgaaaaagtcgggccctcaa
aagcccaagaagccgaccactaccgccggtgacaccgctacgaataagcccaccgaatct
gccaacgatagtacagaccctcgcgagcccaaaaaattcaccgcttcagagagacgttct
caggccgaggagccaaaggtaccacaacttcgtgtgttatccacaacaaccgatctcaga
acgacatgtttgtcctccaagactggaacttgtattcttgctatcgtacccgtacctagc
gacccaaatctacctccatcaatgagtgctctccaagctctaaactctctttcggatatc
gagcgcaagcatgctttgcgtcaggcgcgcctcttccctttttacgttgccccagatgac
attgaagaagttcctaagctccgagacgaactgggcctcaagtctgacatcgttgaaata
attgccatcaacggaaagcgaggatggtggcgtcgatacgattctgccgatggctcaaag
tatggcgttgttgacttggagaaatgggttgatcaagttcggatgggagaggccgagaag
cacaagattcctgagggagctcttctgagcgagagcaaggaggaaccgaaagtggaaccc
gaggtcacccctgaacaagaacctgaaaaggaacctgagcaagaacctgaggcacctcca
caggatgagccagaacagaagacagaaaaagaacccgatcatgaacctgaagcgacaccc
tcagctacccccgagacggaaccacagcaagagactaccgaatccccgaaggaaccgaag
accgcagtacatgaagagctgtga

DBGET integrated database retrieval system