KEGG   Coccidioides immitis: CIMG_05075Help
Entry
CIMG_05075        CDS       T01114                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
cim  Coccidioides immitis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CIMG_05075
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CIMG_05075
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CIMG_05075
Enzymes [BR:cim01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CIMG_05075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 723 aa AA seqDB search
MEGIKQTFAQCKREGRSALVAYVTAGYPRPDETVDIILGMEEGGADIIELGVPFTDPIAD
GPTIQRANTQALQHGVTITSVLEMVRQARDRGLRAPVLLMGYYNPLLRYGEEKILKTAKA
AGINGFIMVDLPPEEAVRFRDLCKKEGLSYVPLIAPATSDSRMRLLCSIADSFIYVVSRM
GVTGATGRLSTGLPELLARVHSYSGNIPAAVGFGVSTREHFLNVQEIAEGVVIGSQMITV
LGEAPEGQRAQKVKEYCSSITGRTVDRSKLSEPFTREIDLTEALAEAQEPTGAQVDKVIK
EGSSSGPGLVDQLEALNVTGDPAAIPARFGEFGGQYVPESLMDCLAELEAGFNEAKNDPK
FWEEYRSYYPYMGRPSNLHFAQRLTEHAGGANIYIKREDLNHTGSHKINNALGQVLLAKR
LGKTRIIAETGAGQHGVATATVCAKFGMECVVYMGAEDVRRQALNVFRMKLLGASVVAVE
AGSRTLRDAVNEALRAWVVDLETTHYIIGSAIGPHPFPTIVRTFQSVIGEETKQQMKELT
GRLPDAVVACVGGGSNAVGMFYPFADDLSVKLLGVEAGGDGIETGKHSATLSGGTKGVLH
GVRTYVLQDEHGQISETHSISAGLDYPGVGPELSSWKDTSRAEFIAATDAQALIGFRTIA
ELEGIIPALESSHAVYGVIELAKKMGKGKNIVLNLSGRGDKDVQSVADALPVIGPKIGWD
LRF
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atggagggcataaagcagacatttgcacaatgcaagcgagagggacgctctgcgctggtt
gcgtatgtcaccgcggggtatccccgccctgacgaaaccgttgatatcatattgggcatg
gaagagggtggagccgatatcatcgagctcggcgtgccctttacagatcccattgccgat
ggccccaccatccagcgcgcgaatactcaggcgttgcaacatggtgttactatcacttct
gtgcttgaaatggttcgccaggcgagggatcggggattgagagctcccgtgctgcttatg
ggctactacaacccgctcttgcgatatggcgaggaaaagatactgaaaactgctaaagcc
gccgggatcaatggcttcattatggttgatctgccaccagaggaagccgttcgatttaga
gatctatgcaagaaggaagggctctcgtatgtccctctgattgcccctgctacctcagac
tcccgaatgagactactctgcagcatcgccgattcttttatctatgttgtgtcgagaatg
ggtgtcactggcgccacgggtcgactaagtacgggccttccagagcttctggcacgagtt
cacagctattccggaaatataccagctgcggtaggtttcggtgtgagcacgagggagcat
ttcctgaacgtccaagaaattgcagagggcgtcgttatcggaagccaaatgatcacggtg
ctgggtgaagcacctgaaggccagagagcccagaaggtcaaagagtactgttcaagcatc
acgggaaggacggttgatcggagcaagctgtcagagccgttcacgagggaaattgacctc
actgaggcactggcagaagcgcaggaacccacgggggcacaagtcgacaaagttatcaag
gagggttctagctcaggaccgggactcgttgaccagctcgaggctcttaatgtgaccggg
gatccagctgcgatcccagcacgctttggagagtttggtgggcaatatgttccggagtca
ctcatggattgtctcgccgaactggaggctggatttaacgaagccaaaaatgaccctaaa
ttctgggaagaatatcgctcgtactacccttacatgggacgtcccagtaatctgcatttc
gctcagcgcctcaccgaacacgctgggggcgctaacatttacatcaagcgagaagatcta
aatcatacaggaagtcacaaaatcaataacgcactcggccaagttttgcttgcaaagcgt
cttggaaagaccagaatcattgccgaaactggagcaggccagcacggtgtagctaccgca
actgtgtgcgcaaagtttggcatggagtgtgttgtttacatgggtgcagaggacgtccgt
cgacaggcgctcaatgtgttccgcatgaagcttctcggggcgtccgtggtagctgttgaa
gctggctctcggacactccgtgacgccgtcaacgaagcacttcgtgcctgggtcgtcgat
ctcgaaactacacactacatcatcggctcggcgattggccctcatcccttcccgactatc
gttcgtacattccagtcggtaatcggtgaagagacgaagcagcaaatgaaggagctaaca
ggcagactccccgatgccgtggttgcttgtgtcggcggaggtagcaatgctgttggcatg
ttctatcccttcgccgacgatcttagcgtcaaactgctcggtgtcgaagctggaggcgac
ggaattgaaacgggaaagcactcggcgactctctctggaggaaccaaaggtgttcttcac
ggcgtgcgaacctacgttctccaggacgaacacggccagatctccgaaactcactccatt
tcggctggtctagactatcccggcgtcgggccggaattaagttcttggaaagacacctcg
agagccgagttcattgctgccacagacgctcaggctcttattggtttccggactattgcc
gagttggaaggcattattcccgccctggaatcgtcccacgcagtgtacggcgtgatcgag
cttgcaaagaagatgggcaaggggaagaacattgtactgaatttgagtggccggggcgac
aaggatgtgcagagtgtcgctgatgctttgcccgtcattgggccaaagattggatgggat
ttgagattttaa

DBGET integrated database retrieval system