KEGG   Coccidioides immitis: CIMG_05096Help
Entry
CIMG_05096        CDS       T01114                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
cim  Coccidioides immitis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CIMG_05096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 112 aa AA seqDB search
MGKDGYAPGDAAKGANLFKTRCAQCHTLEKGGANKVGPNLHGLFGRKTGQAEGFSYTDAN
KQKGITWDHETLYVYLENPKKYIPGTKMAFGGLKKAKDRNDLITYMEQECTK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggacggctacgctcccggtgacgccgccaagggtgccaacctcttcaagacc
cgctgcgctcaatgccacaccctcgagaagggcggtgccaacaaggtcggccccaacttg
cacggtctcttcggccgcaagaccggtcaggctgagggcttctcctacaccgacgccaac
aagcaaaagggtatcacttgggaccacgagactctctacgtctacctcgagaaccctaag
aagtacattcccggtaccaagatggccttcggtggtctcaagaaggctaaggaccgcaac
gacttgatcacctacatggagcaagagtgcaccaaataa

DBGET integrated database retrieval system