KEGG   Coccidioides immitis: CIMG_05279Help
Entry
CIMG_05279        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
cim  Coccidioides immitis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CIMG_05279
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     CIMG_05279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 308 aa AA seqDB search
MSSWTSKENINGVYIPSALLIFGTTIIKKEWIAYATALAVVLSAWKLFSNKPRKVLNPTE
FQNFVLKDKTIVSHNVCIYRFALPRPTDILGLPIGQHISLAATIPGQSKEIVRSYTPISS
DDDAGYFDLLVKSYPQGNISKHLTTLRIGDKMKVRGPKGAMVYTPNMVRHIGMIAGGTGI
TPMLQVIKAIIKGRPRNGGNDTTQIDLIFANVNPDDILLKEELDQLAKEDDAFRIYYVLN
NPPEKWNGGVGFVTPDMIKAKLPAPAGDIKVLICGPPPMVSAMKKATESLGYKKANLVSK
LEDQVFCF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagctcttggacgtcaaaggagaatattaacggggtgtatatcccgtccgccctactg
atcttcggtaccacaatcatcaagaaggaatggattgcgtatgcgacagctcttgctgtt
gtcctttcagcgtggaaattattcagtaacaagccgcgaaaagttttaaatcccacggag
ttccaaaactttgtcctcaaagacaagactattgtctcccacaatgtctgtatctaccgc
ttcgctctcccaagaccaaccgacatcctcggccttcccatcggccagcacatttctctt
gctgccacaatccctggtcagtcgaaggagatcgtgcgctcctacactcccatctcctct
gatgacgatgcgggctacttcgatcttctcgtcaagtcatacccacaaggaaatatctcc
aaacatttgactaccctccgcattggcgataaaatgaaggttcgtggaccaaagggtgcc
atggtctatactccaaatatggtccgtcatatcggtatgattgctggtggtaccggtatc
actcccatgctccaggtcatcaaggctattatcaagggaaggccccgaaatgggggcaac
gatactactcagatcgaccttatcttcgccaacgtgaacccagatgacattcttctcaag
gaggaattggatcagcttgccaaggaagacgacgctttccgcatttactacgtccttaac
aacccaccagagaaatggaacggtggtgttggcttcgttactccagatatgatcaaggct
aaactccctgctccggccggtgatatcaaggttctcatttgcggacctccccccatggtc
agcgccatgaagaaggccaccgagtccctcggatacaagaaggccaacctcgttagcaag
cttgaggaccaggtcttctgtttctaa

DBGET integrated database retrieval system