KEGG   Coccidioides immitis: CIMG_05383Help
Entry
CIMG_05383        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cim  Coccidioides immitis
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cim00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CIMG_05383
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CIMG_05383
Protein kinases [BR:cim01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CIMG_05383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 485 aa AA seqDB search
MPIFGGLLKKRRTKDPKASKDLQSTASSSAESPSSVPSASSQRSSPQLGQHSTVNTSASA
APPERPIDAGTSDATQLNISSATPDVRAGATGDSTVRSQMNSQQIQNHSPVPGGSPQPVS
PQHHQNVASIKNIINPPQQEEVLSQGANDGRFPSQQPVRTTQRQLKGKYSLNDFTLRRTL
GTGSFGRVHLVQSVHNQRFYAIKVLKKQQVVKMKQVEHTNDERRMLERVKHPFLITLWGT
FQDAKNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSQNIVYRDLKP
ENLLLDRHGHLKITDFGFAKEVRDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIF
EMLCGFTPFWDSGSPMKIYENIVHGRVKYPPFLVPDARDLLSQLITPDLTKRLGNLRGGS
EDVKNHAWFSEVTWDRLARKDIDAPYIPPVKAGQGDASQFDTYPEETEQYGLPADDEFGH
FFQEF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccgattttcggaggcctcctcaagaagcggcggacgaaggacccaaaagcgtcaaaa
gacctacaatccacagcctcgtctagtgctgaatcaccttcatcggttccatcggcaagt
tcacagcgtagttcgccacagctcggccagcattcgactgtcaatacgtccgcttccgct
gcccctcctgagcgaccaattgacgccggaacgtccgacgctacacaactgaacatctct
tccgcaaccccagacgtccgtgcgggtgctacgggtgatagcaccgtccgttctcaaatg
aactcgcaacaaatccaaaatcattctcctgtccccgggggatctccgcaaccagtatcc
ccgcagcaccatcaaaatgtcgcaagtatcaaaaacatcataaatccacctcaacaggaa
gaagtactctcccaaggagccaatgacggtcgctttccttcccagcagccagttcggacg
acccagagacaattgaagggaaaatattcccttaacgacttcacactccgccgcaccttg
ggaacaggcagttttggaagagtacacctggtgcagtcggtacataaccaacgtttctat
gcgataaaggtattgaaaaaacaacaagtagtgaagatgaagcaggtggagcataccaat
gatgagcggagaatgttggaaagggtgaagcatcctttcctaatcactctctggggaacc
ttccaggatgccaagaatctgtacatggtgatggactttgtggagggtggagagctattc
agtttgctccgcaagtcgcagcgattcccgaacccagtcgcaaagttttatgcagccgaa
gtcacacttgcattagaatacctacattcacaaaacatcgtttatagagatctcaaaccc
gagaatcttctcctcgatagacatggtcatctcaaaatcactgatttcggcttcgccaaa
gaagttcgggatataacatggacactttgtggaacgcccgactatcttgctccagaagtg
gtttcctcgaagggatacaataaatcagttgactggtggtcccttggaatccttatcttc
gaaatgctttgcggctttacaccgttttgggatagtggatctcccatgaaaatatatgag
aatatcgtccatggccgggttaagtaccctccattcttagtccccgatgctcgggatctt
ttgtcgcaactcatcacccccgatctcacgaagcggctaggtaaccttcggggcggatcg
gaagatgtcaaaaaccacgcatggttctcggaagttacttgggacagacttgccaggaaa
gatatcgatgctccgtatatacctccggttaaagctgggcaaggagacgctagccagttc
gacacctaccccgaagaaacggagcaatacggcctaccagctgatgatgagtttggccat
ttcttccaagaattttaa

DBGET integrated database retrieval system