KEGG   Coccidioides immitis: CIMG_13464Help
Entry
CIMG_13464        CDS       T01114                                 

Gene name
CIMG_05383
Definition
(RefSeq) AGC/PKA protein kinase
Organism
cim  Coccidioides immitis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 485 aa AA seqDB search
MPIFGGLLKKRRTKDPKASKDLQSTASSSAESPSSVPSASSQRSSPQLGQHSTVNTSASA
APPERPIDAGTSDATQLNISSATPDVRAGATGDSTVRSQMNSQQIQNHSPVPGGSPQPVS
PQHHQNVASIKNIINPPQQEEVLSQGANDGRFPSQQPVRTTQRQLKGKYSLNDFTLRRTL
GTGSFGRVHLVQSVHNQRFYAIKVLKKQQVVKMKQVEHTNDERRMLERVKHPFLITLWGT
FQDAKNLYMVMDFVEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHSQNIVYRDLKP
ENLLLDRHGHLKITDFGFAKEVRDITWTLCGTPDYLAPEVVSSKGYNKSVDWWSLGILIF
EMLCGFTPFWDSGSPMKIYENIVHGRVKYPPFLVPDARDLLSQLITPDLTKRLGNLRGGS
EDVKNHAWFSEVTWDRLARKDIDAPYIPPVKAGQGDASQFDTYPEETEQYGLPADDEFGH
FFQEF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccgattttcggaggcctcctcaagaagcggcggacgaaggacccaaaagcgtcaaaa
gacctacaatccacagcctcgtctagtgctgaatcaccttcatcggttccatcggcaagt
tcacagcgtagttcgccacagctcggccagcattcgactgtcaatacgtccgcttccgct
gcccctcctgagcgaccaattgacgccggaacgtccgacgctacacaactgaacatctct
tccgcaaccccagacgtccgtgcgggtgctacgggtgatagcaccgtccgttctcaaatg
aactcgcaacaaatccaaaatcattctcctgtccccgggggatctccgcaaccagtatcc
ccgcagcaccatcaaaatgtcgcaagtatcaaaaacatcataaatccacctcaacaggaa
gaagtactctcccaaggagccaatgacggtcgctttccttcccagcagccagttcggacg
acccagagacaattgaagggaaaatattcccttaacgacttcacactccgccgcaccttg
ggaacaggcagttttggaagagtacacctggtgcagtcggtacataaccaacgtttctat
gcgataaaggtattgaaaaaacaacaagtagtgaagatgaagcaggtggagcataccaat
gatgagcggagaatgttggaaagggtgaagcatcctttcctaatcactctctggggaacc
ttccaggatgccaagaatctgtacatggtgatggactttgtggagggtggagagctattc
agtttgctccgcaagtcgcagcgattcccgaacccagtcgcaaagttttatgcagccgaa
gtcacacttgcattagaatacctacattcacaaaacatcgtttatagagatctcaaaccc
gagaatcttctcctcgatagacatggtcatctcaaaatcactgatttcggcttcgccaaa
gaagttcgggatataacatggacactttgtggaacgcccgactatcttgctccagaagtg
gtttcctcgaagggatacaataaatcagttgactggtggtcccttggaatccttatcttc
gaaatgctttgcggctttacaccgttttgggatagtggatctcccatgaaaatatatgag
aatatcgtccatggccgggttaagtaccctccattcttagtccccgatgctcgggatctt
ttgtcgcaactcatcacccccgatctcacgaagcggctaggtaaccttcggggcggatcg
gaagatgtcaaaaaccacgcatggttctcggaagttacttgggacagacttgccaggaaa
gatatcgatgctccgtatatacctccggttaaagctgggcaaggagacgctagccagttc
gacacctaccccgaagaaacggagcaatacggcctaccagctgatgatgagtttggccat
ttcttccaagaattttaa

DBGET integrated database retrieval system