KEGG   Coccidioides immitis: CIMG_05403Help
Entry
CIMG_05403        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cim  Coccidioides immitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 528 aa AA seqDB search
MEDQSAWTCSSNDAVQVSIVQPKGDGKLSTLSTFYPEFTYSIFGDSETIFGYMGLMIQLR
FAAHDLRSNVCISYDEKFKTVKDISAVDLNKILKPFLPEESFTPLKKFEESLTKDKSAKD
FKPPGEIVHTYTKGDRNYEVWAGCLADPDVQELLERIQIFASLFIEGGTPIEINDPEWTL
ERWMVYFVYEKLPEPPTPDASIYSFVGYGTTYKWYFYSPTSEKCKVSNGPFPYETVINLA
ELPSRLRISQFLILKPHQLSGHGTQLYQTIHRASLKDPTVYELTVEDPNEAFDSLRDTND
YHLLQPVFRHHNVTINANPYPATQSGRAQHRLVPTSRLIPVETLRDIRTKYKIAPTQFAH
LVEMYLLSLIPMSHRGSHNVNLPRLRILKSRAPDEHDRRYYWWRMLVKQRLFKRHRDMLI
QIDQAERVQKLEETLHNVEEGYENLLKAFGMKVTREPAESATPVTDEQQIQEEESGARAE
HAVVRERTKRRFVVMEDEDEDDGDDQGVSSEGGGEKDNTNPPSKKARV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggaggaccaatctgcatggacctgcagctccaatgacgccgttcaagtctccatcgtc
cagccaaagggcgatggcaagcttagcacgctctcaacattctaccctgagtttacttat
tccatttttggcgacagcgaaacgatatttggatatatgggattgatgattcagcttcgc
tttgcagcgcatgatttgagatcgaacgtttgcatctcatacgacgagaaattcaaaacg
gtcaaggacatctctgcggtggatttaaacaaaatattaaagccattcttaccagaagaa
tcgttcactcccctcaaaaagttcgaggaatccctgacgaaggataagtctgcaaaagat
tttaaaccccccggagaaattgttcatacgtacactaagggcgatcgcaattatgaagta
tgggctggttgtctagccgatccggatgtccaggagctcttggagcgtattcagatattt
gcgtctctcttcatcgagggtggaaccccaattgaaataaatgaccctgaatggacctta
gaaagatggatggtatactttgtatatgagaaattgcccgagcctcctaccccagatgct
tctatctactccttcgtgggatacggtacaacatacaagtggtacttttactccccaacg
agcgaaaagtgcaaagtttcgaacggcccctttccgtacgaaaccgtgattaacctggcg
gaactaccgtcgcgcctccgcatctctcaattcctcatccttaaacctcatcaattatct
ggtcatggcactcagctttatcaaactatccatcgtgcctccctcaaagaccctactgtc
tacgagcttactgttgaagatccaaacgaggcctttgactctctccgcgacacaaacgat
tatcatctccttcaacccgttttcagacaccacaatgtcacaattaacgcaaacccgtat
cccgccactcaatcaggccgtgctcagcaccgcctcgttcctacatcccgtcttatcccc
gttgagactctccgcgacatccgtacaaaatacaaaatcgcaccgactcaatttgcccac
ctggtagaaatgtacctgctcagccttatccccatgtctcatcgtggctctcacaatgtc
aacctaccccgactacgtattctcaagtcccgtgctccagacgagcatgataggcgatac
tactggtggcggatgcttgttaagcagcgactgttcaaacgccatcgagacatgctgatt
cagattgaccaggctgaacgagtgcagaagctcgaagaaaccctacataatgttgaagaa
ggctatgagaacttactcaaagcctttggcatgaaggtaacaagggagccggctgaaagc
gcaacgcctgtaacggacgagcaacagatccaggaagaagagagtggagctcgcgcagaa
catgcggttgtcagagagcggacaaagagaagatttgttgtcatggaggacgaggatgaa
gatgatggtgatgatcaaggtgtcagtagcgaaggaggtggcgagaaagacaatacaaat
ccaccctccaaaaaggccagagtgtag

DBGET integrated database retrieval system