KEGG   Coccidioides immitis: CIMG_05416Help
Entry
CIMG_05416        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cim  Coccidioides immitis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 430 aa AA seqDB search
MWKASERLMDTISHYASFPATGVSLRQMVQFGHRPSTGTLFRASQFLSEELPIRLAHRVK
ELGDLPDGLNDMPSIRKVQDWYAQSFEHGREPKLLDEATQNPSVKNGQYRSSTTSILQQT
KDLCINGNGGNGGVNGTTKHRVSGNRRYFVAADDGGDWPPELRDYNNRFASTLHHIKRRH
DSVVTTVAQGILEWKRKRQRLQIDSNIQSFLDRFYMSRIGIRMLIGQHIALTQQTHEYHP
NYVGIICTKTNVRELAQEAIENARFVCEDHYGLFDAPKVRLVCKDDLNFMYVPGHLSHML
FETLKNSLRAVVETHGPENDSFPEIKVIVAEGREDITIKISDEGGGIPRSSIPLVWTYMY
TTVDQTPNLDPDFNKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGTDVYLHLN
RLSSSSEPLQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggcatcagaacggctgatggacaccatcagccactatgcctcgtttccagcg
acaggagtttccctaaggcagatggttcagtttggacatagaccatcaacaggaactctc
tttcgcgcatcccaattcctgtcggaagaactcccaatccgcctagcacacagagtcaag
gagctgggcgacctgccggatggattaaacgacatgccttcgataagaaaggtgcaggat
tggtatgcacagtcattcgagcatggccgcgagccgaaactcctcgatgaggcaacacaa
aatccgagtgtgaaaaacggccaataccgctcctccacgacatccatcctccagcagaca
aaagacctgtgcattaacggcaacggcggcaatggaggtgtaaatgggactacaaagcac
agagtcagcgggaaccgaaggtactttgttgccgcagacgacggaggcgactggccaccc
gaactcagggattataacaaccggttcgcttcgacgctacatcacatcaaaaggcggcat
gatagcgtggtcacgacagttgcgcaaggaattctggaatggaaacggaaaaggcagcgg
ctgcagattgactctaatatacaatcgttccttgatcgtttttacatgtctcgtatcggt
atacgaatgctgatagggcaacatattgcccttacacagcagacgcatgaataccacccg
aactatgtcggaatcatctgtaccaagacgaatgtccgtgaacttgcgcaggaagcgatt
gagaacgcgcggttcgtctgtgaagatcattatggattatttgacgcacccaaggttcgc
ctcgtctgcaaagatgatttgaattttatgtacgtcccggggcatctgtcgcacatgctt
ttcgaaactctgaagaattcgttgcgtgctgttgtagaaacacatggcccggagaatgat
tcgttccctgagatcaaggttattgtcgcggaaggccgcgaggatataacaattaaaatt
tccgacgaaggagggggtatcccaagatcgtcaattcccctagtttggacgtatatgtac
accacagtggatcagactccaaatttggacccggattttaataagagcgattttaaggct
ccaatggctggttttggctatgggcttccgatcagtcggctctatgcacggtatttcggc
ggtgacttaaagttgattagcatggagggatatggcacagatgtctaccttcaccttaac
cgcctttcttcgagctcagagccccttcaatga

DBGET integrated database retrieval system