KEGG   Coccidioides immitis: CIMG_05416Help
Entry
CIMG_05416        CDS       T01114                                 

Definition
(RefSeq) pyruvate dehydrogenase kinase
  KO
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     CIMG_05416
Protein kinases [BR:cim01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   CIMG_05416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 454 aa AA seqDB search
MWKASERLMDTISHYASFPATGVSLRQMVQFGHRPSTGTLFRASQFLSEELPIRLAHRVK
ELGDLPDGLNDMPSIRKVQDWYAQSFEEIISLPRPTLSQEVRARLLRPSRQHGREPKLLD
EATQNPSVKNGQYRSSTTSILQQTKDLCINGNGGNGGVNGTTKHRVSGNRRYFVAADDGG
DWPPELRDYNNRFASTLHHIKRRHDSVVTTVAQGILEWKRKRQRLQIDSNIQSFLDRFYM
SRIGIRMLIGQHIALTQQTHEYHPNYVGIICTKTNVRELAQEAIENARFVCEDHYGLFDA
PKVRLVCKDDLNFMYVPGHLSHMLFETLKNSLRAVVETHGPENDSFPEIKVIVAEGREDI
TIKISDEGGGIPRSSIPLVWTYMYTTVDQTPNLDPDFNKSDFKAPMAGFGYGLPISRLYA
RYFGGDLKLISMEGYGTDVYLHLNRLSSSSEPLQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaggcatcagaacggctgatggacaccatcagccactatgcctcgtttccagcg
acaggagtttccctaaggcagatggttcagtttggacatagaccatcaacaggaactctc
tttcgcgcatcccaattcctgtcggaagaactcccaatccgcctagcacacagagtcaag
gagctgggcgacctgccggatggattaaacgacatgccttcgataagaaaggtgcaggat
tggtatgcacagtcattcgaggaaattataagtttgccacggccaaccctttcgcaggaa
gtcagagctcgccttctacggccgagtcgccagcatggccgcgagccgaaactcctcgat
gaggcaacacaaaatccgagtgtgaaaaacggccaataccgctcctccacgacatccatc
ctccagcagacaaaagacctgtgcattaacggcaacggcggcaatggaggtgtaaatggg
actacaaagcacagagtcagcgggaaccgaaggtactttgttgccgcagacgacggaggc
gactggccacccgaactcagggattataacaaccggttcgcttcgacgctacatcacatc
aaaaggcggcatgatagcgtggtcacgacagttgcgcaaggaattctggaatggaaacgg
aaaaggcagcggctgcagattgactctaatatacaatcgttccttgatcgtttttacatg
tctcgtatcggtatacgaatgctgatagggcaacatattgcccttacacagcagacgcat
gaataccacccgaactatgtcggaatcatctgtaccaagacgaatgtccgtgaacttgcg
caggaagcgattgagaacgcgcggttcgtctgtgaagatcattatggattatttgacgca
cccaaggttcgcctcgtctgcaaagatgatttgaattttatgtacgtcccggggcatctg
tcgcacatgcttttcgaaactctgaagaattcgttgcgtgctgttgtagaaacacatggc
ccggagaatgattcgttccctgagatcaaggttattgtcgcggaaggccgcgaggatata
acaattaaaatttccgacgaaggagggggtatcccaagatcgtcaattcccctagtttgg
acgtatatgtacaccacagtggatcagactccaaatttggacccggattttaataagagc
gattttaaggctccaatggctggttttggctatgggcttccgatcagtcggctctatgca
cggtatttcggcggtgacttaaagttgattagcatggagggatatggcacagatgtctac
cttcaccttaaccgcctttcttcgagctcagagccccttcaatga

DBGET integrated database retrieval system