KEGG   Coccidioides immitis: CIMG_05459Help
Entry
CIMG_05459        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cim  Coccidioides immitis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CIMG_05459
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CIMG_05459
   00020 Citrate cycle (TCA cycle)
    CIMG_05459
   00620 Pyruvate metabolism
    CIMG_05459
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CIMG_05459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 495 aa AA seqDB search
MASAAVMSRFPSCRLLVSRPASTLRESRNVYRLRDAARPQLPLYASLARYYASKSYPPHT
IISMPALSPTMTAGNIGAWQKKVGDTLSPGDVLVEIETDKAQMDFEFQEEGVLAKILKEA
GEKDVSVGNPIAVMVEEGTDIAQFGSFSLEDAGGDKKPSADKTPKETPESSKGPEAEAEG
QSLAQDEAKPAAEEPDITGERLQPSIDREPLISPAAKALALERGVPIKTLKGTGPGGRIT
KEDVEKYQPTTAVGAAAGPTYEDIPASSMRKVIASRLTQSMKDNPHYFVSSTLSVTKLLK
LRQALNSSADGKYKLSVNDFLIKACALALRKVPAVNSAWIEQNGQVVIRQHNTVDISVAV
ATPVGLITPIVKGVEGLGLESISRQVKDLGKRARDNRLKPEEFNGGTFTISNMGMNPAVE
RFTAVINPPQAAILAVGTTRKVAVPLETEEGTEVQWDDQIVVTGSFDHKVVDGAVGAEFM
RELKKVVENPLELML
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctgcggtgatgtcgcgattcccttcttgtcgtctacttgtctccagaccc
gcttccaccctacgagagtcgcggaatgtgtacagactgcgcgatgccgcacggccacaa
ttgcctctctacgcttcccttgcgagatactatgcctcgaaatcttatcctccccatact
atcatcagcatgccagcattgtcgcccacaatgaccgcaggtaacatcggcgcatggcag
aaaaaggtcggcgacacactgtcaccaggcgacgtcctggtcgaaattgaaacagacaag
gcacaaatggacttcgagttccaagaagaaggtgttcttgcgaaaattttgaaggaagct
ggagaaaaggatgtttctgttgggaatcccattgccgtcatggttgaagaaggcaccgat
atcgcccagttcggatcattttccctggaagatgctggcggcgataagaagccatctgct
gataagactccaaaagagactcccgagtcctcaaagggacctgaagccgaagccgaaggc
caatcgctcgcacaggacgaggctaagcccgccgcagaagaaccagatatcactggggaa
cgccttcaaccatccattgatagagaaccgttgatcagcccggctgccaaggcccttgct
ttagaacgtggagtgccaataaagaccctcaagggaacaggccctggaggtcgaatcacc
aaggaagatgttgaaaaataccagcccaccacggccgtcggtgctgctgcaggcccaacc
tacgaagatattcctgcctcatcaatgcgtaaggtcattgcaagccgcctcactcaatcc
atgaaggataacccccattacttcgtttcctcaactttgtccgtcacaaaactcctcaaa
cttcgccaagctctaaactccagtgcagacggcaaatacaagctctccgttaatgacttc
ctcatcaaagcatgtgctctcgcacttcgcaaagtccccgctgtcaattcagcttggatt
gagcagaatggacaggttgtgattcgccagcataatacggttgatattagcgttgcggtc
gcgactcctgttgggctcattactcccatcgtgaaaggcgtggagggacttggcctggaa
agcatttcgcgtcaagttaaggatctcggcaagcgtgcccgagacaataggctaaaacct
gaggagttcaatggtggcaccttcaccatcagcaacatgggtatgaatcctgcggttgaa
agatttactgctgtgatcaaccctcctcaagctgccatacttgctgtcgggactacacga
aaggtagccgtgcctttggagacggaagagggtactgaggtgcagtgggacgaccagatt
gtggtcactggaagctttgaccacaaggtggtcgatggggcagttggggccgagttcatg
cgagagttgaagaaagtggtcgagaaccctcttgaacttatgctatga

DBGET integrated database retrieval system