KEGG   Coccidioides immitis: CIMG_05483Help
Entry
CIMG_05483        CDS       T01114                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CIMG_05483
Peptidases [BR:cim01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CIMG_05483
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 1527 aa AA seqDB search
MSSTGGANGKSTSCDQPMQDAQNGHPDYRSSSPTLKRPAAEMGGDEQKENGDSMDTDPPS
SKSIIEMQIDNSHLKKKNDRPDRHARAASVDMIGRDNDTGPKTSSEEATSSGSDSVYPTP
SSMSTYTHSTYEERSQAISSHSNHSSHAVPSLDEQVATVMQMVMQPPQEKQRGYVVSGTW
LNRVLARSSKGPMRDKSDKTAAEGEIGPVDNSDLVLVTDPSTLFKDEAGEPFVPLRPGLQ
MGEDFEIFPQEAWDLIISWYGLSKNSPAIVRYAHNTNTPGNTENIQYELNPPVFTILKLP
SPTNPAVQLSTDKSRTPVKTLASSHTPFQQWLRNAKKLASIEPTTKVRVWRILEGLGTSG
TVTPAASRSASPAPGSTLIANAGDSLVLDTNKFAALSEGSQRELVELKDQTSNEKYNGSV
TLHLAGLSGDNVIVLEEQIGGAGGGEWASDAAKYGSSRLAALTTTTTTTKVAPQSKFKSP
AVPTSGRASPVPSVVTRGRKRKDSKTRGVTGLSNLGNTCYMNSALQCVRSVEELTQYFLA
NEYKKDLNPSNPLSHNGDVARTYANLLHQMFDENAPDSISPRNFKLTIGRYGPSFSGYGQ
QDSQEFLLFLLDGLQEDLNRIHKKPYIEKPDSTDDMVHDKAALQEFADRNWEIYKARNDS
VITDLFAGMYKSTVVCPACDKVSIIFDPFSNLTLQLPIENVWSKYVYFFPAHGEPLLIDV
EIDKNASIKALKEYVAKKVNSDPRRLVMAEIYTQKIYKLFSNTSAISDCSIGQSDNIAMY
ELETIPTSYDPDKAKRQSYSMLYTGLRGDDADIVSFDSEQADRILVPIFNRVVKTSVTKY
ARQRPLFGVPRFAVITREEAMDYDAILRKVLAQVNTLTTRDILTEDEDDTTMRSTSAEDS
DAVVTNDDDASSNDSKIKMGSVEGEDGLVDVSMRDATDPSSQGGSTNPSNAPVARVLQPR
SFIPPSLRNLFDVKFVKTQDPAGIAYSSIDDSKEFLSMIDRVRPRKAAKRGGQRMKNVPP
HRSNNSPVSSEDELSRPPISVQVPRNKLTESLSNYSSSEETKEDSGSDTDSDPYPTARSI
RKEKGHKQKGVGSKRGPPSNLPYIRPGEAIVLDWNESAHDALFGGDPRDKESLRGIPTWE
NPQRLPDPELARKRQLRQSKKRMGISLAECLDEFGREEILSENDAWYCPRCKEHRRASKK
FELWTVPDILVMHLKRFSANRGFRDKLDVLVDFPLELDMTGRAQAPNDGKSMMYDLIAVD
NHYGTLGGGHYTAYAKSFADGNWYEYNDSHTSRKSDPSVVVTKAAYLLFYRRRSDHPLGG
SYLAQVTEAAGQKNAADSDSPEDSDGNSGEGKRLDGFSRNGSSSALAGVAAAHQAGDGGL
QGGVLNRNDEDDTLPGYLDSMQAGESSLRRGDDLEGMEIDGYEREYGPGPLSYLRDQGWS
FDRIHAGSYYGNNDDLDDNSSMKAVGGDDTDSETQIQPLGSSEGPAPLFSGNDYDNEHVS
ILGMMDVDEDDEMPVVELSVPDEESSS
NT seq 4584 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaacgggcggtgcgaacgggaagtccaccagctgcgatcagccgatgcaagac
gctcaaaacggccatcctgactaccgatcttcttctcctacattaaagcgcccggctgca
gagatgggtggggacgaacagaaggagaacggggattctatggatacagatcctccgagc
agcaagagcattatcgaaatgcagatagacaactcacacctgaaaaagaagaatgatcgg
ccagacaggcacgcccgggcagcttccgttgatatgatcggtcgggataacgatacaggc
cccaaaacctcatctgaagaggctaccagctccggatcggatagcgtctatccaacccca
tccagcatgtcgacctacacccactcaacctacgaggagagatcccaggcgatctcaagc
cattccaaccactcttcgcacgctgttccttcccttgacgaacaggttgcaaccgtcatg
caaatggtgatgcagcctccacaagaaaaacagcgaggatatgtggtctctgggacttgg
ttaaatagggttctcgcgaggagtagcaaaggtccgatgcgggacaaatctgacaaaact
gctgcagagggtgagataggaccagtggacaactccgatcttgtcctggtcaccgatcct
agcacgctattcaaggatgaagccggagagccgttcgttccgcttcgccccggtttacaa
atgggagaggacttcgagatcttccctcaagaagcatgggatctgattataagctggtac
ggcttgtcaaagaattccccggcgattgttcgatacgcacataacacaaatacccccgga
aatactgagaacatccaatacgagctgaatccgcctgtatttacaatcctaaagttgccg
agtccgacaaaccctgctgtgcaactctcgacagataaaagtcggactcctgttaagacg
cttgccagcagccacactccattccagcaatggctaagaaatgctaagaaacttgcttct
atcgagcccacaactaaggttcgcgtatggaggatccttgagggtttgggcacctctggt
accgttacgccagccgcttcccgaagtgcttcgccagctccgggctccaccctaattgcc
aacgctggggacagcttagttctcgacactaacaagtttgccgccttgagtgaaggctcg
cagagggaacttgttgaactcaaagaccagacttcgaacgaaaaatataacggaagtgtt
acattgcaccttgctggccttagtggtgacaatgttattgttcttgaagagcaaatcggt
ggcgctggtggtggcgaatgggcatcagatgccgcaaagtatgggtcaagccgacttgct
gctctgaccaccaccacaaccactacaaaggtagcaccccagagcaagttcaaatcaccc
gctgttcctactagtggacgtgcgtcacccgtaccatccgtcgttacgcgagggcgaaag
cgcaaagatagcaaaactcgtggtgttaccggtctgagcaatctcggaaatacatgctac
atgaattcggctctgcaatgcgtccggagtgtcgaggagctcacccagtatttcctggcg
aacgagtataaaaaggacctcaacccgagtaacccgctgtcccacaatggcgatgtagcc
aggacctatgccaaccttctccatcaaatgttcgatgaaaacgcacctgattccatttct
ccccgtaattttaaactgacaatcggacgatatggaccttcattttccggctacggccag
caagactctcaagagtttctacttttcctccttgatggtctgcaggaagatctcaatagg
attcacaagaaaccatatatcgagaaaccggattccacggacgatatggtccatgacaag
gctgcattgcaggaatttgccgatcggaactgggaaatatacaaagcgcgaaacgattca
gtgattactgatctatttgccggcatgtacaaatccacagtcgtttgtccagcttgtgat
aaagtgagcatcatcttcgatccgttcagcaacctgaccctccaattacccatcgaaaat
gtatggagtaaatacgtatatttcttcccggctcatggcgagccgcttttgattgatgtg
gagatcgataaaaatgctagcatcaaggcgttgaaggagtatgtggcgaaaaaggtcaac
agcgacccgcggcgtttggtcatggcggaaatctatacccaaaaaatctacaaattgttt
tcgaatacttcggctatcagcgactgttcaatcgggcaatcggataacattgccatgtac
gaattagaaactataccgacaagttacgatccagacaaggcaaagaggcaaagctatagc
atgctttacacgggtttacgcggtgacgatgcagacattgtctccttcgactctgaacag
gcggatcgtatccttgttcctatttttaaccgtgttgtaaagacctctgtcacgaaatat
gcccgtcagcggccgctctttggcgtgcctaggtttgcggttatcacccgcgaggaggca
atggattacgatgcaatactgcggaaagtcttagctcaagttaatactttaacgacgcgg
gatatcctgaccgaagatgaagatgatacaactatgcgctccacctctgcggaagattcc
gatgccgtggtcacgaacgacgatgacgcgagctccaatgactcgaagattaaaatgggc
tctgtggaaggtgaagacggattggttgatgtctccatgcgtgatgctactgacccttct
tcgcagggaggtagtacgaacccttcgaacgcacccgtcgccagagttcttcagccgaga
agcttcattcctccctcgcttcgaaacctattcgacgtcaagttcgtgaagacccaggat
cctgcggggatagcatattcttctatagacgattccaaggaatttctctctatgatagat
agggtgcgaccgagaaaggcggctaaacgtggaggtcagcgaatgaaaaatgttccgcct
caccgttcaaacaacagccctgtcagcagcgaagacgaactttctagaccgcctatttcc
gttcaagttccgcgtaataagcttactgaaagtttgtcgaactactcgagctctgaggag
acaaaggaggacagcgggtcagacactgattcagatccatatcctaccgcccgctcaata
cggaaagagaagggccataaacaaaaaggagtgggttcaaagcgcggccctccatccaat
ctcccttatatccgtcctggcgaggctattgtgctcgactggaacgaatctgctcatgac
gcccttttcggaggagatccccgagataaggaatcgctgcgtggcataccgacatgggag
aatccccaaaggctcccagatcccgaactagcaaggaaacgtcaactacgtcagagtaag
aagcgcatgggcatctcgttagccgaatgcctagacgaatttggcagagaagagattctc
tccgaaaatgacgcttggtactgtcctcgatgcaaagagcatcgccgtgccagcaagaaa
ttcgagctttggacggtgccagacattttggttatgcatcttaaacgattcagtgccaac
cggggattcagagataaattagacgtgctagtcgatttccctcttgaactagatatgacc
ggaagagcccaagcgccgaatgacggcaagagcatgatgtacgacttgattgccgtcgat
aatcactatggtaccctgggtggtggccattacacggcttacgccaagagctttgctgat
ggtaattggtatgaatataatgattcccatacgtcgagaaagtcagatcccagcgttgtt
gtgacaaaggcagcgtacctgttattctaccgtcggcgctcggatcaccctttaggcggg
tcgtatctggcgcaggtaacagaggcagcaggtcaaaaaaacgcagcagactctgattct
cccgaagactctgacgggaattcgggggaaggcaagcgcctcgacggcttctcccgcaat
gggtcgtcgagcgccttagccggagtcgcagcagctcaccaagcgggagatggtggtttg
cagggcggagtcctcaacaggaatgatgaagacgatacgctgcctgggtacctagattcc
atgcaagctggagaaagttctttgagacgtggagatgacttggaaggcatggagattgat
gggtatgaacgcgaatacggcccggggccgttgtcctatctaagagatcaaggttggtca
ttcgatcgtattcacgcaggctcgtactatggtaataatgatgatttggatgataattcg
agcatgaaagccgtcggaggtgatgataccgattccgaaacacaaatacagccgctgggc
agctcggaagggccggctccgctgttctccggcaatgattatgataacgagcatgtgagc
attctgggcatgatggatgttgacgaggacgacgagatgcccgtggtagaactttcagtt
ccagacgaagagtccagcagttga

DBGET integrated database retrieval system