KEGG   Coccidioides immitis: CIMG_06045Help
Entry
CIMG_06045        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CIMG_06045
Transfer RNA biogenesis [BR:cim03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CIMG_06045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 580 aa AA seqDB search
MATETLTLRPATQQRKLPKAAKLPPENERYMRACSDIANALIQDYEAQRDSTKPKKDINL
NKLRGQISKKHSLSTQPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHR
CPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQIKSL
GHSVDKVEYIIMGGTFMSLPEDYREEFIAQLHNALSGYQTNNVDEAVQAGEMSNIKCVGI
TIETRPDYCLDTHLSAMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFKLAKDAG
FKVVSHMMPDLPNVGMERDLFQFQEYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYK
NYTPNALIDIVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALGRMKDFGTTC
RDVRTREVGINEVKNKIRPSQIELIRRDYVANDGWETFLAYEDPKQDILIGLLRLRKCSA
KYTFRPELTGQQTSLVRELHVYGSAVPVHGRDPRKFQHRGFGTLLMEEAERIAREEHGSG
KISVISGVGVRSYYAKLGYWLDGPYMSKMLDPVEPEDAEE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagactctgactctacgtcccgccacccagcagcgcaaattgcccaaggct
gcgaagctacctcccgaaaatgagcgctatatgagagcctgttcggacatagcgaatgcg
ctgattcaggactatgaggctcagagggactcaacgaagcccaaaaaagatatcaacctg
aacaagctgcggggtcaaatttcgaagaagcacagcttgagcactcagcctcctctaaca
gcaatcattgcagcagtcccggagcattataagaagtatattttgccgaagctgatcgca
aagccgataaggacatcttccggtattgcggttgttgctgttatgtgcaagccccatcga
tgtcctcatattgcatacactggaaacatttgcgtgtattgtccaggcggtcctgattcc
gactttgaatactccacccagtcctataccggatacgagccgacgtcaatgcgagctatc
cgcgcccgctatgaccctttcgagcaagcgcgagggcgggtggaccagatcaaatccctt
ggccacagcgtggataaggtggagtatattatcatgggtggcacgtttatgtctttgcca
gaggactacagagaagaattcatagcccagctccataacgcgctcagtggatatcaaaca
aacaatgttgatgaagcggtccaagccggggagatgagcaatatcaaatgtgtcggaatc
acgatagagacacgtccagattattgtttggacactcatctcagtgctatgctcaggtac
ggctgtacgagattggagatcggtgtgcagagtctttacgaagatgtcgcgagagatacg
aaccgaggacacaccgtggcggctgtggcggagacgtttaaactggcgaaggatgctggt
ttcaaggtcgtcagccacatgatgccagatctacctaacgtggggatggaaagagatttg
ttccagttccaagaatactttgagaacccagccttccgaacggacggtctgaaaatctac
ccaacactagttatcagaggtaccggtctctatgagctttggcggactggtcgctacaag
aactataccccaaatgctttgattgacattgtcgctcgcatccttgccctggtgccccca
tggactcgtatctatcgtgtgcagcgtgatattccaatgcctcttgtcacatccggcgtt
gagaacggtaaccttcgcgaactcgctcttggtcgaatgaaagatttcggcaccacttgc
agagacgtgcggactcgagaagttggaattaacgaagtcaagaataagatccgaccaagc
cagattgagctaatacggcgtgattacgtcgccaatgacggatgggagacattccttgcc
tatgaagacccgaaacaggatattctcattggccttctccgtctacgaaagtgcagtgca
aagtataccttccgcccagagcttaccggtcaacagactagtttggtccgtgagctgcat
gtatacggttcagctgttcccgttcacggtcgtgatcctcggaagttccaacatcgcgga
tttggaaccctgttgatggaagaggccgagaggatagcaagagaggagcatggaagtgga
aagattagcgtcatctctggggtcggtgtcagaagttattacgcaaagcttgggtattgg
ctcgatggaccatacatgagcaagatgctcgatccagtggagccggaagatgctgaagaa
taa

DBGET integrated database retrieval system