KEGG   Coccidioides immitis: CIMG_06097Help
Entry
CIMG_06097        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
cim  Coccidioides immitis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CIMG_06097
  Replication and repair
   03420 Nucleotide excision repair
    CIMG_06097
Transcription machinery [BR:cim03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CIMG_06097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 425 aa AA seqDB search
MLEDDIYRTSTQYRLWSFTKESLNSIRENTNSLASVRVRDAIRRAQEARRATSTPGGSDE
PDSKTNTPAGPESEIECLTPEDELELVQYYCEKTLELGDEYKPPLPTTVRATAIQYLRRF
YVTNSPMTYHPKSIMPCALFLATKTDNYYMSLRSFAEKIPNTTAEDIIAPEFLLTQGLRF
AFDIRHPFRGLEGGVMELTAIAKGEGAPGPHHPEQTAAKLQEAIQAIPPAEGAAPSASIT
DRIASAHGKTRQILKTAAQMTDAYFLYTPSQIWLSALLLVDQPLLEFYLDTKLGPAPSGS
SPPASAPESALAMLFALRAKLTGVLESCSTLLGTYLNTHDPNAPPDPARMKNLKRIGKKL
YHCQNPEKFSELSAGRTQRREGSGSTTPALLPTAGGGDVDETEGPAIKKRKLEKEAEEAG
NGGNK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagacgacatctatcggacgtccacccagtaccggctctggtcgttcaccaag
gaatccttaaattctattcgagaaaacaccaattcccttgcgagcgttcgtgttcgagat
gcgatccgtcgggcgcaagaagctcgccgggcgacttcgacgcctggaggcagcgatgaa
ccggattcaaagaccaatacacccgcagggcctgagagtgagattgagtgtttgacgccg
gaagacgaattggaattggtgcaatattattgtgagaaaacgctggagctgggggatgaa
tacaagcctccgctgccgacgacggtgagggccaccgctattcaatatctgcgccgtttc
tatgtcaccaactcgcctatgacctatcacccgaaatcaataatgccctgtgcccttttt
cttgccacgaaaacggacaattactacatgtccctgcgttcatttgcggaaaagatccct
aatacgactgcagaggatattatagctccagaattcctgcttactcagggcctacgattc
gcgtttgacatccgccacccctttcggggcctggaaggcggagtcatggaactcaccgcc
atagcaaaaggcgaaggtgcgcctggtccccatcacccagagcaaacggccgcaaagctc
caagaagccatccaggccattcctcccgcagagggagcggcaccgtcagcctccataacg
gaccgtatcgcctccgcccatgggaaaacaagacaaatcctcaaaaccgccgcacaaatg
acagatgcctacttcctttacacaccctcacagatctggctttctgccctcctcctcgtg
gaccagcccctcctagaattttacctcgatacaaaactcggccccgcgccgtctggttct
tccccgccagccagcgctccagaatccgctctagccatgctttttgccctccgtgcaaag
ctcacgggtgtcctggagtcttgctccacgctcctgggcacgtatctaaacacccatgac
cccaatgcccctccagatccggcccgcatgaagaacctaaaacgcattggcaaaaaactt
taccactgccaaaaccccgagaagttctctgagctaagcgcgggtaggacccagaggagg
gagggttcagggagcaccacgccagccctactacctaccgctggcggaggcgatgtggat
gagactgagggtcctgctatcaaaaagaggaagttggagaaggaggcggaggaggctggt
aatggtggtaataaatga

DBGET integrated database retrieval system