KEGG   Coccidioides immitis: CIMG_06097Help
Entry
CIMG_06097        CDS       T01114                                 

Definition
(RefSeq) cyclin ccl1
  KO
K06634  cyclin H
Organism
cim  Coccidioides immitis
Pathway
cim03022  Basal transcription factors
cim03420  Nucleotide excision repair
Module
cim_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CIMG_06097
  Replication and repair
   03420 Nucleotide excision repair
    CIMG_06097
Transcription machinery [BR:cim03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CIMG_06097
DNA repair and recombination proteins [BR:cim03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     CIMG_06097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N
Motif
Other DBs
NCBI-GeneID: 4562378
NCBI-ProteinID: XP_001242201
UniProt: J3K7E7
AA seq 425 aa AA seqDB search
MLEDDIYRTSTQYRLWSFTKESLNSIRENTNSLASVRVRDAIRRAQEARRATSTPGGSDE
PDSKTNTPAGPESEIECLTPEDELELVQYYCEKTLELGDEYKPPLPTTVRATAIQYLRRF
YVTNSPMTYHPKSIMPCALFLATKTDNYYMSLRSFAEKIPNTTAEDIIAPEFLLTQGLRF
AFDIRHPFRGLEGGVMELTAIAKGEGAPGPHHPEQTAAKLQEAIQAIPPAEGAAPSASIT
DRIASAHGKTRQILKTAAQMTDAYFLYTPSQIWLSALLLVDQPLLEFYLDTKLGPAPSGS
SPPASAPESALAMLFALRAKLTGVLESCSTLLGTYLNTHDPNAPPDPARMKNLKRIGKKL
YHCQNPEKFSELSAGRTQRREGSGSTTPALLPTAGGGDVDETEGPAIKKRKLEKEAEEAG
NGGNK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagacgacatctatcggacgtccacccagtaccggctctggtcgttcaccaag
gaatccttaaattctattcgagaaaacaccaattcccttgcgagcgttcgtgttcgagat
gcgatccgtcgggcgcaagaagctcgccgggcgacttcgacgcctggaggcagcgatgaa
ccggattcaaagaccaatacacccgcagggcctgagagtgagattgagtgtttgacgccg
gaagacgaattggaattggtgcaatattattgtgagaaaacgctggagctgggggatgaa
tacaagcctccgctgccgacgacggtgagggccaccgctattcaatatctgcgccgtttc
tatgtcaccaactcgcctatgacctatcacccgaaatcaataatgccctgtgcccttttt
cttgccacgaaaacggacaattactacatgtccctgcgttcatttgcggaaaagatccct
aatacgactgcagaggatattatagctccagaattcctgcttactcagggcctacgattc
gcgtttgacatccgccacccctttcggggcctggaaggcggagtcatggaactcaccgcc
atagcaaaaggcgaaggtgcgcctggtccccatcacccagagcaaacggccgcaaagctc
caagaagccatccaggccattcctcccgcagagggagcggcaccgtcagcctccataacg
gaccgtatcgcctccgcccatgggaaaacaagacaaatcctcaaaaccgccgcacaaatg
acagatgcctacttcctttacacaccctcacagatctggctttctgccctcctcctcgtg
gaccagcccctcctagaattttacctcgatacaaaactcggccccgcgccgtctggttct
tccccgccagccagcgctccagaatccgctctagccatgctttttgccctccgtgcaaag
ctcacgggtgtcctggagtcttgctccacgctcctgggcacgtatctaaacacccatgac
cccaatgcccctccagatccggcccgcatgaagaacctaaaacgcattggcaaaaaactt
taccactgccaaaaccccgagaagttctctgagctaagcgcgggtaggacccagaggagg
gagggttcagggagcaccacgccagccctactacctaccgctggcggaggcgatgtggat
gagactgagggtcctgctatcaaaaagaggaagttggagaaggaggcggaggaggctggt
aatggtggtaataaatga

DBGET integrated database retrieval system