KEGG   Coccidioides immitis: CIMG_06405Help
Entry
CIMG_06405        CDS       T01114                                 

Definition
(RefSeq) histone deacetylase clr3
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CIMG_06405
Protein phosphatases and associated proteins [BR:cim01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CIMG_06405
Messenger RNA biogenesis [BR:cim03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     CIMG_06405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 760 aa AA seqDB search
MDADEDIVMTGTGPTVPVGAGQPSSASPKKLGTEPQLNGAFQAESLLASFQRKVVAPGNL
IKEVEDQQASSVPTVKSEENKEEPEQKEEAEISTDEDESVSSDQSDEVPKLLPVSSLPSG
VCYDIRMRYHCEVKPTLDVHPEDPRRIYYIYKELCKAGLVDDPDASRPLVSQPLLRIPAR
DATHEEISLIHDSEHYDFVLSTKDMSEDELIALESTRDSIYFNTLTFTSAILACGGAIET
CKAVVSGKVKNAIAVIRPPGHHAEQCQAMGFCLFNNVSVAARVCQKTFKDKCRKIMIVDW
DVHHGNGVQNAFYDDPNVLYISLHVYKDGAFYPGGEQGNWDHCGEGNGLGKNVNIPWPTQ
GMGDGDYLYAFQEVIMPIGYEFNPDLVIISAGFDAAAGDELGGCFVTPPCYAHMTSMLMN
LANGKVAVCLEGGYNFRSISKSALAVTRTLMGEPPDRLIGAGASQAGVSTVRKVTMIQSK
YWQCMYPKGPPERFWGNRVHDIIRQYQAKQLYDEYKLTSLFIYRNSISKSFENQVLASRN
YDWQVPLLVIFHDPPELMGIPHPLTNKLEAHNCWMADGVKDYIEWAMNRNIAVIDVNIPK
HITRSNTADRYEDEDRSKEKMASELAVYLWENYIEPNEASHVFFLGVGDAFGGLADLLIE
KERVYPRVSGVISFVAENVVRAVSSHTNIWLSKWYKDNSLIYVSHHHGVFNIPEGSKRPS
KRYGRILRSPKKTLNEMLLAHMDDVTKWIEERIQGETEEE
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagacgaggacatcgtcatgacggggactggcccaacggtccctgtcggggct
ggtcagccgtcaagcgcctctccgaaaaagctaggtacggaaccacaattgaacggagct
tttcaggccgagtcgctattagcatcgtttcaaagaaaagtcgtggcgcccgggaatcta
attaaagaagtggaagatcagcaagctagctccgtcccgaccgtgaagtcggaagagaat
aaggaagagcccgagcaaaaggaagaagcggagatctctacagacgaggacgagtctgta
tcgtcggatcagagcgatgaggtcccgaaactacttcccgtttcgtcgttgccgtctggc
gtgtgctatgacattcggatgcgctatcattgtgaggtcaagccgactctagatgttcac
ccagaggacccaaggcgtatctactacatttacaaggagctttgcaaagctggacttgtc
gatgatccagatgcttcaaggccgcttgtatctcagccattgcttcgtattcctgcgaga
gatgccacgcacgaggagatatcgttgattcacgattctgagcattatgactttgttctc
agcacgaaagacatgtccgaagatgagttgattgcattggagagtactcgagactcgata
tatttcaatactctcacgtttacttcggcgattctagcctgcggcggtgccattgaaact
tgcaaggcagtggtctcaggaaaggtgaagaacgcgattgcagtgattcgtcctcctgga
caccacgcagagcagtgccaggcaatgggcttttgcctgtttaataacgtcagcgttgcg
gcaagagtttgccagaaaactttcaaggataagtgccggaaaataatgattgtggattgg
gatgtgcaccatggcaatggagtccaaaatgcgttttatgacgacccaaatgtgttgtat
atctctctccatgtctataaagatggtgctttctacccaggcggcgagcaggggaattgg
gaccactgtggtgaaggcaatgggctaggaaagaatgtcaatatcccatggccaacccaa
ggcatgggtgacggtgactatctctatgctttccaggaagttatcatgccaattggctac
gagtttaatccggatcttgttatcatctcggccgggttcgatgctgctgcaggtgatgag
ctcggaggctgcttcgtcactccgccgtgctatgctcacatgacttctatgctgatgaat
cttgcgaatggcaaagtagctgtttgcttggagggtggatacaacttccgctcgatttcg
aaatccgcgctcgcggtgactagaacgctgatgggagagccaccggacagactcattggt
gctggtgcgtcacaggcgggagtctcgacagtgcgtaaggtaaccatgattcagtctaag
tactggcaatgcatgtatcctaaagggcctccggagagattctggggtaatcgagttcac
gatatcattcgacaataccaagcgaaacagctttacgatgagtacaagctaactagcctg
ttcatctatcgaaattctatttccaaatcttttgagaatcaagttcttgcaagtcggaat
tatgattggcaagtcccgctactcgtcatcttccatgaccctccagagctcatgggaatc
ccccatcctctgaccaataagttggaggcacacaactgctggatggctgatggcgtcaag
gactatattgaatgggcaatgaacaggaacatagccgttatcgacgtcaatatcccaaag
cacatcaccaggagcaataccgccgataggtacgaggatgaggaccggagcaaggagaag
atggcaagcgagcttgcagtttatctctgggaaaattacatcgagccaaacgaagctagc
cacgttttctttctgggagttggcgacgcgtttgggggtctcgcagacttgctcatcgaa
aaagagcgcgtataccctcgcgtcagcggcgtcatctcctttgttgccgagaacgtagtc
cgggcagtgtcaagccacacaaacatctggctttctaagtggtataaagataactcttta
atatatgtttcgcaccatcacggcgtcttcaacattcccgaaggctccaagagaccttca
aagcgctacgggcgcattcttagatccccgaagaagaccctcaacgagatgctccttgcc
cacatggatgacgtgacgaagtggatagaagagagaatccaaggggagaccgaagaagag
tga

DBGET integrated database retrieval system