KEGG   Coccidioides immitis: CIMG_06461Help
Entry
CIMG_06461        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cim  Coccidioides immitis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CIMG_06461
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CIMG_06461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MPARIRVIGSLNADMVTVTPRFPGPGETLTATSFNTSAGGKGANQAVACGRLSRSQPRSS
TSDTQDEEIYVEMIGAVGRQDSYFSTLLKPTLEQSGVDIARIREVDGVHTGIAVIVVDSS
AGGENRILLSPGANYAGMQPTADLFDSVLSPPRPDVVVVQAEIPLTTVVEVLRRAGRQKE
QLRKEGIKGVDGAVEVVFNPAPAPAGGLPTDVYAAIDHLIMNETECDLMAPKELRDISEP
EERRGQIANHFHSLGVRYVIVTLGSEGVWYSAADVGSKAQDDVKTWIRCINHIPAAKVEK
VVDTTGAGDTFVGGYSVQVARWREQRRLLGKANECLTDDERRERYHKGIEEAIRWAVRAS
AQCVQRQGAMDSIPWKGEI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgccagcccggattcgagtcatcggctctttgaatgccgacatggtcacagtgacccca
cgcttccccgggccaggagaaactctgacagcgacatccttcaacaccagcgcaggtggc
aagggcgcaaaccaggccgtggcctgtggccgcctttcccgctcacagcctagatcgtcg
accagtgatacccaggatgaggagatttatgttgaaatgatcggtgccgtgggccgccag
gattcgtatttctctactctcttgaaaccaactctagaacagtctggtgtggatattgcg
cggattagggaagtggatggtgtgcatacaggcatcgccgtgattgttgttgacagttcg
gctggtggcgagaataggattttgctctctccaggtgccaattacgcggggatgcagcct
acagcagaccttttcgactcagtactgtcgcctcctcgaccagatgtggtggtggtgcag
gcagagatcccactgacgacggtggttgaagttctgaggcgcgccgggcgtcaaaaggag
caactacgcaaagaaggtatcaagggcgtggatggagcggtcgaggtcgtgtttaacccc
gctccggctccagcgggcggcctacctacagacgtatatgcggcaattgaccatttgatc
atgaacgaaacggaatgtgatcttatggcgccgaaggagctgagggatatctccgagcca
gaagaacgcaggggccagatcgcaaaccatttccatagcttaggtgtacggtatgtcata
gttacactgggctcggagggagtatggtatagtgcagctgatgtgggcagcaaggcccaa
gacgacgtcaaaacgtggattcgctgcattaatcacattcctgccgcaaaagtggaaaag
gttgtggacaccacgggtgcgggagacaccttcgtgggcggctattcggtgcaagtggct
cgatggagagagcagagacggttgcttgggaaggccaacgaatgccttacagatgatgag
cggagagaacggtatcacaaaggaattgaagaggcaattcgatgggcggtccgggcttcg
gcccagtgtgttcagcggcaaggagccatggatagcattccatggaagggagagatctga

DBGET integrated database retrieval system