KEGG   Coccidioides immitis: CIMG_06516Help
Entry
CIMG_06516        CDS       T01114                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cim  Coccidioides immitis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CIMG_06516
Enzymes [BR:cim01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CIMG_06516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 338 aa AA seqDB search
MGSETSLPLGPKPKSAVPSYLLNGLSSDRMPSSKRERDSLNSSIKTSFARRQISNEDIGE
NGTSPPTRTAGASALESRDSGRLLEKQPDGTGSTKRNISEPPRDPRDHIVPTPIVSRPAS
PYTLNPPIDFDGLSWPSIGTRERLESTPEETEERIQKLAGAVRTIFECIGEDPEREGLLG
TPERYAKAMLYFTKGYEENVRDLVNGAVFHEDHDELVIVKDIEVFSLCEHHMVPFTGKMH
IGYIPDRRVLGLSKLARLAEMFSRRLQVQERLTKQVALAIAEVLKPQGVAVVMESSHLCM
VMRGVQKTGSTTTTSCMLGCMRSSAKTREEFLSLLNRK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgggatccgaaacctcactacctttgggcccaaagcccaaatctgcagttccttcctat
cttctgaacggcttatcttccgatcgcatgcccagcagtaagcgcgagagagatagtctc
aattcttccataaaaacatcttttgcacgaagacagatctctaacgaggatatcggtgag
aatggcacctcaccgccgacacgcactgccggcgccagtgcccttgagagcagagatagc
gggcggcttttggagaagcaacctgatggcactggaagcacaaagcgaaatatcagcgaa
cctccgcgtgatcctagggatcacattgtccccactcctattgtcagtcgacctgccagc
ccgtataccctaaatccgcctatcgatttcgatgggcttagttggcctagcattgggaca
agggagcgactagaatccactccagaagaaacagaggaaagaattcaaaagcttgcggga
gctgttcgaaccatattcgaatgcattggcgaagatccagaacgagagggattacttgga
accccagagagatatgcgaaggcaatgctttattttaccaagggatacgaggagaatgtc
cgggatttggtgaacggcgctgtctttcacgaagatcatgatgaacttgtgattgtgaaa
gatattgaagttttttctctctgtgagcatcatatggttcctttcactggaaagatgcat
atcggttacatccccgatcgcagggtcctcggattatccaaacttgctcgactagccgaa
atgttttctcggcgcctccaggttcaagagcgactgacaaagcaggttgccttggctatt
gctgaagtgttgaagccccagggtgttgccgtcgttatggaatcgagccatctatgcatg
gtgatgcgtggagttcagaagactggcagcaccaccactactagttgcatgcttggctgt
atgagatcaagcgcgaagactcgggaagaatttttgagcttgctgaaccgaaaataa

DBGET integrated database retrieval system