KEGG   Coccidioides immitis: CIMG_06545Help
Entry
CIMG_06545        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
cim  Coccidioides immitis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CIMG_06545
Messenger RNA biogenesis [BR:cim03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     CIMG_06545
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CIMG_06545
Translation factors [BR:cim03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    CIMG_06545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MENANLWTRRSNSSRLSLSVSDNRDSHGRSDSPRSSSKRFGDGHGRSNPFNAISPLSTGV
SSPSTNASSAFGLGSGAFASFGSAAKTPKTPGAFDFNSSKSRTEKQDGEHSGTGSKSVKS
KGSSSSLNSTNTSGPKEHPLKSTWVVWYRPPTPKYSDYEKSTIALASISSVESFWAVYSH
LKRPSLLPTVSDYHIFKKGIRPVWEDQANKKGGKWIVRLKKGVADRYWEDLLLAMIGDQF
AEASDEVCGAVLSVRSGEDVLSVWTRIDGGRNIKIRETMKRLLNFPPDTNIVWKSHDDSI
AQRTAIDQARQDKAANSGHHQGSDRRRGANPDDSTGEKGKGSAS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggagaacgcaaatctatggaccaggagatccaactccagcaggctttctttatcggta
tctgataatcgagattcacatggaaggtctgattcaccgcgtagctcgtcaaaacgattc
ggtgacgggcatggtcgctcaaatccgttcaatgcaatctccccgctttccacaggcgta
tcatcaccctccaccaatgcttcctcagcctttggccttggttccggcgctttcgcttct
ttcggatcggcagcgaagactccaaagacaccaggcgcatttgatttcaactcctccaaa
tctcgaaccgaaaaacaagatggagagcacagtggaacgggctcgaagagcgttaaatcc
aagggttcttcatcctccctcaacagtaccaataccagtggaccaaaggagcatccttta
aaatcgacgtgggttgtctggtatcgcccacccacaccaaagtactccgactacgaaaaa
tctacaattgccttagcatcgatatcttccgttgagagcttctgggccgtctattcacac
cttaaaagaccatctctccttcctacggtttcagattatcacatctttaagaaagggatt
cgccctgtatgggaggatcaagcgaataaaaaaggcgggaagtggattgttaggttgaag
aaaggagttgcagaccgttattgggaagaccttcttttagccatgattggcgatcagttc
gccgaggcgagtgacgaggtctgcggtgcagtccttagtgtccgcagcggcgaagacgtt
ttaagtgtgtggacaaggattgatggaggccgcaatatcaagattagggaaacaatgaaa
cggctattgaatttcccaccggataccaacattgtgtggaagagtcatgatgatagtata
gcccaaaggaccgctattgaccaggctcggcaagataaagctgcaaattcgggccatcac
caaggttccgaccgccgacgcggagccaatcctgatgattccacaggggaaaaggggaag
ggttcagcatcttga

DBGET integrated database retrieval system