KEGG   Coccidioides immitis: CIMG_06775Help
Entry
CIMG_06775        CDS       T01114                                 

Definition
(RefSeq) AGC/PKA protein kinase
Organism
cim  Coccidioides immitis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 389 aa AA seqDB search
MAMETIRQPQEQCRPEIHCEPQDIDTKKIGFPPWPSSRPKTPQDIVENREHIKERLPKHN
LKVEDFELLKTLGTGTFARVWLVRLKNVKDKNNSIFALKVLRKADVIELKQVEHVRNENN
ALHAVAGHPFITTLIASFSDDQCLYMLLDYCPGGEIFSFLRRIRRFNEPTAKFYAAEIVL
ILEYLHDVQGVAYRDLKPENILLDAEGHLKLVDFGFAKQLYSHETYTLCGTPEYLAPEVI
HNSGHGLAVDWWALGILMYEFLVGQPPFWDPNPLRIYEQIVEGRLRFPSHVTPEARDIIS
ALCKTNPSERLGYISGGTKRVKEHPFFKGINWDDLYHRRIPGPIIPRVDHPADAGNFEEY
PPPPDPSTQTVYTEEMKKKYEACFKDFND
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcgatggagacgatccggcagccgcaggagcaatgtcggccggagatacattgcgaa
ccccaagacatcgacaccaagaaaatcgggttcccgccctggccttcctcaaggcccaag
acgccgcaggatattgttgagaatcgagagcacatcaaggagcgactgcctaaacacaac
ttgaaggttgaggatttcgaattactgaagacgctggggaccggcacgtttgcgcgagta
tggctcgttcggctcaagaatgtaaaggacaagaacaactcaattttcgcactaaaggtc
cttcgcaaagctgatgtcatcgaactcaaacaagtggaacatgtccgtaatgagaacaat
gctcttcacgctgtcgctggacatccgttcatcacaactctaattgcctctttttccgac
gaccaatgcctctacatgctattagactattgccccggcggtgaaatattcagcttcttg
cgtcgcatacgacgattcaacgagcccaccgctaaattctacgctgccgaaatagtatta
atccttgaatacctccacgacgtacagggcgttgcatatcgtgacctaaaaccagagaac
atccttcttgacgctgaggggcacctcaaactagttgatttcggtttcgcgaagcaactc
tatagtcatgagacatatacactctgtggaacacccgaatatctcgcgccggaagtcata
cacaacagtggccatggcctggcagttgactggtgggcactaggaattctgatgtatgaa
ttcttagtaggacagcctcccttctgggatccaaaccctttgcggatatatgagcagatc
gtcgagggccgcctgcgcttcccgtctcacgtaacaccagaagcacgggacataataagt
gcgctatgcaagaccaatccgtccgaaagattggggtacatatcgggtggaacaaaacgg
gtgaaggagcacccgttcttcaaaggaataaactgggacgatctgtatcaccgacggata
ccagggccaataataccacgtgttgatcacccggccgacgcagggaatttcgaggagtat
ccgcctccaccagatccaagtacgcaaactgtatatacggaagagatgaaaaagaagtat
gaggcctgttttaaggacttcaacgattaa

DBGET integrated database retrieval system