KEGG   Coccidioides immitis: CIMG_06831Help
Entry
CIMG_06831        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
cim  Coccidioides immitis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CIMG_06831
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    CIMG_06831
Enzymes [BR:cim01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     CIMG_06831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1151 aa AA seqDB search
MAYRSSTESDGRHRSGSKSSSESSQLTPLQDGFTPLSSSAPPGWGFNTSTVASISSIVPS
GPLPSSSAVTSPLHTSIDTSTRNVRNDAIDAPFLASPLPLELPESVMGIGTQSTFTDGPL
GNVAFNKAPGIMRRLSRGAASKLGRRGSLNSHDKRDHSSGPVIMRRRSDSKTSVSKDSAL
DSSVEEDDKPDPLKARCGPDRVSFGDEYRLSLDSTAGVAPRVDPLLQCGSLLTKVTKQRK
KYKTFFLDVDTAKVYWDLSNPSKRFYIDDIKEIRLGPDARNYREEHQVPIEFESRWFTII
FANPEGSKNRPVKALHLIAPTRFIVELWTTTLEQISRYRIGLMVGLAGSGQSETILKAHW
QREIARRFPGSPRTFEDECLDVGAVENLCHSLHVNCSKRVLRGQFARVDADGRGKINFSQ
FQSFVQHLKDRKDIRKIFDSVVAESRGGLSIEEFFEFLRSAQGEDVDKNRDYWASVFERF
VRRSRRSQSLPEALSSSAARMDLDAFSSFLISPANGIYPTHVPPPKFDLPLNDYFISSSH
NTYLLGRQVAGASSTEAYIAALQKGCRCVEIDCWDGPDGRPIVSHGRTMTTSVLFADCIS
VIDRYAFLSSDYPLILSLEVHCNAEQQIAMTNIMKNEFGDKLLLEPLRADWPILPSPEAL
KGKILIKVKTSDESEEKISGSSKVMGRKRSSSSPFIQSTTQNSFPTNSSFSSPPTIGPID
GLPPVLTQPKRSLTGTSLSSASEESDTAFATMPFPGKRKMPKSRVIKVLADLGVYARGYK
WRGFDTPESKQFNHVYSFAERSIETICRDSENKALLEAHNRLYLTRVYPSGYRLRSSNFD
PNSFWRRGVQMAALNWQTFDVGMQMNQAMFAAGNDRTGYVLKPESLRVPPSSRHTMDGKP
KIDRQLVRFRVDVISAQQLPRSRGMGPDDSINPYIEIEILCADDKKKGMAFGEGGVDASN
RNGFSGIGLPHRRRTQIEQKNGFNPIFGDEFKFSLETKYPDLVFVRWIVWNSTDGRSFGG
NNSIQLATFTAKLSSLAQGYRYLPLYDSNGDQYLFSTLFCKITKLESAPAAQRRDIEESK
SERKGIFRQLGQSMFKRALSTEREKDVARQKSRLTGSIRKSDSLNREKNETSSSSSSSSS
LPILSTVPSGQ
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcgatcttcaaccgagtcagatggacgccatcgatcaggatccaaatcgtcg
tccgaatcctcccagctaactccattgcaagatggtttcactcccctcagctcctctgcg
cctccgggctggggctttaacacctccacggtggcgtctatctcttccattgttccttca
ggtccgcttccaagctctagtgccgtcacctcaccattgcatacgtcgatagacacctca
actcggaacgttcgaaatgatgcaatagatgccccattccttgcctcgcccctgccatta
gagttaccagaatcggtaatgggcataggaacgcaatcaaccttcacagacggaccttta
ggaaacgttgcattcaacaaagcacctggcataatgcggcgactgtctaggggtgctgct
agcaagcttggtcggcgaggatcgctaaattcccatgataaacgagatcatagctcgggt
cccgttattatgcgcagaagaagtgatagtaagacatcagtttccaaagatagcgcactc
gattctagtgttgaggaggacgacaaacctgaccctcttaaggcccggtgtggaccggat
cgagtttcatttggcgacgaataccgactttctctggatagcaccgcaggggtggccccg
agagtggatcctcttttgcaatgtggttcacttctcacaaaagtaacgaagcaaagaaag
aaatataagactttctttctggacgttgacactgcgaaggtgtattgggacctctcaaac
ccatccaaacgattttatatcgatgatatcaaagaaataagattgggtccagacgcgcgg
aactatcgagaggaacatcaagttcctatcgaatttgagagccgctggtttacgattatt
ttcgccaaccccgaaggatcgaagaataggccagtcaaggcgctgcatttgatagcaccg
actcggttcatcgttgaattgtggactacgactctggaacaaatttccagatatagaatt
ggacttatggttgggttagcgggctctggtcaaagtgaaactatattaaaggctcactgg
cagcgtgaaattgctcgaagattccctgggagcccaagaacttttgaagacgaatgcctc
gacgttggcgctgttgaaaatctctgccatagcctccatgtcaattgttcgaaacgagtt
ctacgtggtcaatttgcgagagttgacgcagacgggagggggaaaataaatttctctcaa
ttccaaagcttcgttcaacatctaaaagatcgcaaggacataaggaagattttcgattct
gtagtcgctgagagcaggggcggcctaagtattgaggagttctttgagttccttcgcagt
gcacagggagaagatgtcgataagaatagggattattgggcatcggttttcgaaagattt
gttcgaagatccaggcgttcacaaagccttccagaggctctatctagctcggctgcacgc
atggatcttgatgctttctcgtcttttttgatatctcctgcgaacggtatatatccaacc
catgtacccccgccgaagtttgatctgcctttaaacgactacttcatctcaagttcacac
aacacatacctacttggaaggcaagttgctggtgcttcgagcacggaggcgtatatcgct
gcacttcaaaaaggctgccgctgcgtcgaaattgattgctgggatggtccagatggccgt
ccgatcgtctctcatggtaggacaatgaccacgagtgtcctctttgcggactgcatatct
gtcatcgaccgttatgccttcctatcttccgactatcctttgatcttatcgcttgaggtt
cattgtaacgcggaacaacaaattgccatgaccaacatcatgaagaatgaatttggcgac
aaacttctacttgaaccgcttcgggcagattggccgattcttccaagcccggaggcattg
aagggtaaaattttgatcaaagtgaaaacgtctgacgaaagtgaggagaaaatctccggt
tctagtaaagttatgggccgcaaacgaagctcgagctcccctttcatacagtcgaccacc
caaaattcatttcctacaaattcttcgttctcgtctccaccgacaatcggcccaatcgat
ggactacccccggtgttaactcaaccgaagcgttctctgactggtactagtctgagtagt
gcttccgaggagagtgatacagcttttgccacaatgccatttcctggtaagaggaagatg
cccaaaagcagagtgatcaaagttctcgcagatcttggtgtctacgctcgtggctataaa
tggcgaggctttgatacgccggaaagcaaacaattcaatcacgtatactcctttgctgaa
cggtctattgaaacaatatgccgagactctgaaaacaaggctcttctagaagcacacaat
cgattgtatctcacaagggtctacccgtcagggtatcgattgcgttcatcgaactttgac
ccaaatagcttctggagacgaggtgttcagatggctgcactcaactggcagacttttgat
gttggaatgcaaatgaatcaagccatgtttgccgctggcaatgatcgtacaggatacgtg
ctcaaaccggaaagcttgcgagtgccaccatcgtcaaggcatacaatggatggcaagcca
aagatcgacagacaattggttcgtttccgcgtggatgtgatttctgctcagcagcttcct
cgatctcgaggaatggggcctgatgatagtatcaatccgtacatcgagatcgaaatactg
tgtgcagatgataagaagaaaggtatggcgttcggcgaaggtggtgtggatgcgtctaat
cgaaatggattttcgggcattggccttcctcaccgtcgtcgaacacagattgagcagaaa
aatggcttcaatccgatcttcggggacgagtttaaattttctctggaaactaaatatcca
gatctcgtcttcgttcgctggatcgtgtggaactccaccgacggccgtagttttgggggt
aacaacagcatacagctagctacattcacagcaaagcttagcagtctggcgcaaggctat
cgatatctgcctctttatgacagcaacggcgatcagtacctattttcaacgctattttgc
aaaatcaccaaactcgaatctgccccagctgcgcaacggcgcgacattgaagaatccaaa
agcgaacggaagggtatctttcgacaacttggccagtcgatgttcaagcgtgctctctcg
accgaacgagagaaagatgttgctcgacagaaaagcagactcactggcagcattcgaaaa
tccgattcgttgaaccgagagaagaatgagacatcatcatcatcatcatcatcatcatct
ctccctatcctcagcactgtcccatcaggtcagtga

DBGET integrated database retrieval system