KEGG   Coccidioides immitis: CIMG_07173Help
Entry
CIMG_07173        CDS       T01114                                 

Definition
(RefSeq) Poly(A)+ RNA export protein
  KO
K14298  mRNA export factor
Organism
cim  Coccidioides immitis
Pathway
cim03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CIMG_07173
Messenger RNA biogenesis [BR:cim03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     CIMG_07173
Chromosome and associated proteins [BR:cim03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    CIMG_07173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Ge1_WD40 WD40_like FliO
Motif
Other DBs
NCBI-GeneID: 4562245
NCBI-ProteinID: XP_001243277
UniProt: J3K9S2
AA seq 359 aa AA seqDB search
MSSALFGSTTSTTGDLSKDVALSSPPEDSISDLAFSSVSDHLAVASWDKKVRIYEINEQG
MSEGKALFEHQGPVLNCCWSPDGTKVVGVGADKAARMLDLAGNPSNPVQVAAHDAPIRCC
RMISNPANSSQPLLVTGSWDKTVKYWDLRQSTPIASLDCQERVYTMDVRNKLLVIGTADR
YINIVNLDQPTKFYKTMQSPLKWQTRVVSCFTDATGFAVGSIEGRCAIQYVEDKDSSSNF
SFKCHRESPSGSTTISNVYSVNSIAFHPTHGTFSTAGSDGTFHFWDKDAKHRLKGFPNVG
GTISCSTFNRNGNIFAYAVSYDWSKGYTGNTPQTPNKVMMHPVAAEEVRPRPSNARRTR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagccctctttggctccaccaccagcacgacaggcgatctctctaaggatgtt
gccctgtcctcgccgccggaggatagcatctccgatctcgcattttcaagtgttagcgac
caccttgcagtggcatcatgggataagaaagtccgtatctacgagatcaacgaacaagga
atgagtgaagggaaagcgctgtttgagcaccagggtcctgttctgaactgctgttggtcg
cctgatggaaccaaggttgtcggtgtcggtgcagataaagccgcccgtatgctcgactta
gctggcaaccccagcaatcctgttcaagtcgcagcgcatgacgcgcctattcgatgctgc
cgcatgatttcaaatccagcaaattcaagccagcctttgctcgtcaccggctcgtgggat
aaaactgtaaagtactgggatctgcgacagtctacgcccattgcgtctctcgattgtcaa
gaacgggtatacacaatggacgttaggaacaagcttctcgtcatcggcacggcagatcga
tatattaatattgtgaatctggaccaacctacaaagttctacaagaccatgcaatcgccc
ctcaagtggcaaacaagagttgtcagctgcttcacggatgctacagggttcgcagttggc
agcattgagggtcgctgtgcgattcagtatgttgaagacaaggattctagctcgaacttc
agtttcaagtgtcaccgcgaaagccccagtggctccacaaccatcagcaacgtctattct
gtcaattccatcgccttccaccccacacacggcacattcagtacggcaggcagcgacgga
acgttccatttttgggataaagatgccaagcacagacttaagggatttccaaatgtcgga
gggacgatttcctgttccaccttcaaccgtaacgggaacatttttgcctatgcagtgagc
tatgactggagcaagggatatactggcaatactccacaaactccgaataaggtcatgatg
catcctgtcgccgcagaagaagtccgacctcgcccttcaaacgcacgcaggaccagatga

DBGET integrated database retrieval system