KEGG   Coccidioides immitis: CIMG_07173Help
Entry
CIMG_07173        CDS       T01114                                 

Definition
similar to SONA
Orthology
K14298  
mRNA export factor
Organism
cim  Coccidioides immitis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CIMG_07173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MSSALFGSTTSTTGDLSKDVALSSPPEDSISDLAFSSVSDHLAVASWDKKVRIYEINEQG
MSEGKALFEHQGPVLNCCWSPDGTKVVGVGADKAARMLDLAGNPSNPVQVAAHDAPIRCC
RMISNPANSSQPLLVTGSWDKTVKYWDLRQSTPIASLDCQERVYTMDVRNKLLVIGTADR
YINIVNLDQPTKFYKTMQSPLKWQTRVVSCFTDATGFAVGSIEGRCAIQYVEDKDSSSNF
SFKCHRESPSGSTTISNVYSVNSIAFHPTHGTFSTAGSDGTFHFWDKDAKHRLKGFPNVG
GTISCSTFNRNGNIFAYAVSYDWSKGYTGNTPQTPNKVMMHPVAAEEVRPRPSNARRTR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcagccctctttggctccaccaccagcacgacaggcgatctctctaaggatgtt
gccctgtcctcgccgccggaggatagcatctccgatctcgcattttcaagtgttagcgac
caccttgcagtggcatcatgggataagaaagtccgtatctacgagatcaacgaacaagga
atgagtgaagggaaagcgctgtttgagcaccagggtcctgttctgaactgctgttggtcg
cctgatggaaccaaggttgtcggtgtcggtgcagataaagccgcccgtatgctcgactta
gctggcaaccccagcaatcctgttcaagtcgcagcgcatgacgcgcctattcgatgctgc
cgcatgatttcaaatccagcaaattcaagccagcctttgctcgtcaccggctcgtgggat
aaaactgtaaagtactgggatctgcgacagtctacgcccattgcgtctctcgattgtcaa
gaacgggtatacacaatggacgttaggaacaagcttctcgtcatcggcacggcagatcga
tatattaatattgtgaatctggaccaacctacaaagttctacaagaccatgcaatcgccc
ctcaagtggcaaacaagagttgtcagctgcttcacggatgctacagggttcgcagttggc
agcattgagggtcgctgtgcgattcagtatgttgaagacaaggattctagctcgaacttc
agtttcaagtgtcaccgcgaaagccccagtggctccacaaccatcagcaacgtctattct
gtcaattccatcgccttccaccccacacacggcacattcagtacggcaggcagcgacgga
acgttccatttttgggataaagatgccaagcacagacttaagggatttccaaatgtcgga
gggacgatttcctgttccaccttcaaccgtaacgggaacatttttgcctatgcagtgagc
tatgactggagcaagggatatactggcaatactccacaaactccgaataaggtcatgatg
catcctgtcgccgcagaagaagtccgacctcgcccttcaaacgcacgcaggaccagatga

DBGET integrated database retrieval system