KEGG   Coccidioides immitis: CIMG_07197Help
Entry
CIMG_07197        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cim  Coccidioides immitis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CIMG_07197
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CIMG_07197
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 203 aa AA seqDB search
MFVPCRIAVRKFRPVVISGPSGTGKSTILKRLFAEFPDKFSFSVSHTTRGPRAGEVDGRE
YYFTSKEAFLNLVDEGGFIEYAQFGGNYYGTSTMAVKNISEKGRVCILDIEMEGVKQVKK
TDLNARFLFLAPPSIEELERRLRGRGTETEDSLSKRLAQASNELEYAKQPGAHDKIVVND
DFDIAYKSVRDWIVDNGNFGATL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtgccctgccgcattgcagtgcgcaagtttcgccctgtggtgatttccgggcca
tcagggacgggcaagtccacgatccttaagcggctctttgccgagtttcctgataagttc
agcttctcggtatctcataccactcgaggccctcgtgctggcgaagtcgatggtcgcgaa
tactactttacaagcaaggaagcctttttaaatcttgttgacgaaggcggctttatcgaa
tatgctcaattcggtggcaattactatggaacgagcaccatggcggtgaaaaatattagt
gaaaaagggagggtttgtatattggatattgaaatggagggagtcaagcaagtcaaaaag
accgaccttaatgcccggttcctattcctcgcccctccatctatcgaagaactagagcgc
agactccgtggccgcggaacagagacggaagatagcctcagtaaacggttggcgcaagca
agcaatgagctagaatatgccaagcagccgggagctcatgacaaaatcgtagtcaatgat
gattttgacatagcttacaagagtgtgagagattggatcgtggacaatggcaattttggc
gcaacactttga

DBGET integrated database retrieval system