KEGG   Coccidioides immitis: CIMG_07220Help
Entry
CIMG_07220        CDS       T01114                                 

Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cim  Coccidioides immitis
Pathway
cim00860  Porphyrin and chlorophyll metabolism
cim01100  Metabolic pathways
cim01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CIMG_07220
Enzymes [BR:cim01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CIMG_07220
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CIMG_07220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 4562279
NCBI-ProteinID: XP_001243324
UniProt: J3K9W0
AA seq 373 aa AA seqDB search
MSFSTLVQDIAYRDSHPDDRSSILSRGGRTRSHASTAATSVSISGDISSQLHAGYSHPLN
RIWQAERQLTKSMLIYPLFITDVPDEETPIPSLPNQYRRGINRLVPFLTPLVKKGLRSVI
LFGVPLAPNAKDALGTAADDPAGPVIQTIRLLRAQFPQLYIVTDVCLCEYTSHGHCGILR
EDGTLNNALSIDRISDVALAYAEAGAHCVAPSDMNDGRVRAIKLKLIEAGIAHRVLLMSY
SAKFSGCLYGPFRDAAGSAPTSGDRKCYQLPPGGRGLARRAIQRDIAEGADIIMVKPAGS
YLDIISDAKELGRDMPVAAYQVSGEYAMIHAGAKAGVFDLKSMATESTEGILRAGAGIVV
SYFTPEFLDWLSS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtccttctcaacacttgtccaagacatcgcatacagagactcccatcccgatgaccgc
agctcaatcttgtcgagaggaggcaggactcgatcccatgccagcacggccgcgaccagc
gtaagcatttccggcgacatctcgagccagttacatgctggctacagccatccactgaac
cgcatctggcaagctgagaggcaattaaccaagtctatgcttatttaccccctcttcata
accgatgttcctgatgaagaaactcctatcccatccctaccaaatcaataccgtcgtgga
attaaccgtctcgttccctttctcacccccctggtaaagaagggccttcgttcggttatc
ctttttggggtccctcttgcccctaacgccaaggatgctctcggtacagcagcggatgac
ccggcaggcccagttattcaaaccattcgcctccttcgcgcacaatttcctcagctctac
atcgtaactgatgtctgtctgtgtgaatacacttctcatggccattgcgggattctgcga
gaggacggcacgttgaacaatgctctatccattgatcgaatttccgacgtggccctagca
tatgcagaagctggagcgcattgcgttgctccttccgatatgaatgatggtcgggtccgc
gccatcaaactcaaactaatcgaagctggcattgcgcatcgcgtgctcctcatgtcctac
agtgctaaatttagtggatgtctatatggaccgttccgcgatgcggcaggatcagctcct
acttctggcgaccgtaaatgttaccaactaccacctggtggccggggtctcgcccgtcgt
gcaattcagagagatatagccgagggtgcagatattatcatggtgaaaccggcaggtagt
tacctcgacatcattagtgacgccaaggaactaggtagggacatgcccgttgcggcatat
caggtcagcggtgaatatgcgatgattcatgcgggtgctaaagccggtgtgtttgatctg
aaatcaatggcaacagaaagtacagagggcattctgcgcgccggtgccggcatcgtggtg
agctacttcacaccagaatttttggactggctcagttcctga

DBGET integrated database retrieval system