KEGG   Coccidioides immitis: CIMG_07236Help
Entry
CIMG_07236        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
cim  Coccidioides immitis
Brite
Enzymes [BR:cim01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CIMG_07236
Peptidases [BR:cim01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CIMG_07236
Exosome [BR:cim04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CIMG_07236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 648 aa AA seqDB search
MEVVRGTEIMLPFTMLARDEPPPKMSKLAIKPLREEDHYNTTIKVICYDCDNDDVDISSI
PVLQDVIDGVMNTLTFSRKEEVKAWELELTSCEHILCLTQDDASLMQLNTLHLAHWGIMI
TEQKKTEKSLTEMQIEQNLKWEFTMTSSDGMDLKPIFGPGLTGLRNLGNSCYLASALQCL
FSLPEFEYRYFKPQELPPVVPLPAEDLETQLRKIADGLISGRYSVPNSDTVAHTGCQDLP
YQLGLAPGMLKHLIGRGHDEFSTMRQQDAFEFLLHLFKLINVNKHYDTPNPVASFRFNLE
QRLQCLSCGKVRYKIDEQDNISVPVPIRRLKEDNDAESCASGETPVSSKFDRVSLRECLD
IFTAEEIVELTCSGCESKKGFRKRSLFKTFPQNLIINARRFELINWVPTKLNIPVEVSDE
PLDLSQYRSLGIQAGEILLEDEPSPPDIEFQPNEEAVAMLLSMGFPEIRIKKALYATGNT
DTDAALNWLLSHMDDPDIDTTDISAPPGSGGNHCSNEDEAKIGQLIDMGIDRPKARKALL
ETDGDINRALDWVLSHPYDAEIEGYQVSSGSPAQLQGSSDIPALFQLHAIICHKGVSVHA
GHYVAFVRKEVAQDEDNQWVLFNDEKVVQGGDIEEMKQFAYIYFFRKL
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggaggttgtacggggaacagagatcatgctgcccttcaccatgctcgctcgtgatgaa
cctccccctaaaatgtcgaaattagcgatcaagcccttaagagaagaagatcattataac
accactatcaaagtaatatgttatgattgcgacaatgatgatgttgatatctcttctatc
ccagtgttgcaggatgtgatagatggtgtcatgaacaccctcacattctctcgcaaggaa
gaagtaaaggcatgggagcttgaacttacatcatgtgaacatatcctgtgtctcacccag
gatgatgctagtttaatgcaacttaacactttgcacctagcacactggggaattatgatc
actgagcagaaaaaaaccgagaaaagtctcacggaaatgcagattgagcaaaaccttaaa
tgggagtttacaatgacttcaagcgatgggatggacctaaagcctatctttgggccagga
ctcaccggcttgcgaaacctcggcaacagttgctaccttgccagtgctctccagtgcttg
ttctccctaccggagtttgaataccgatattttaaaccacaagagcttcctccagtagta
cctttaccggcggaggatctcgaaactcaactaaggaaaatagccgatgggcttatttca
ggccgttactctgtcccaaactccgatacggtggcccacacgggctgtcaagacctacct
tatcagttggggctagctccaggaatgctaaaacatttaattggtcgcggtcatgatgaa
ttttcgacaatgcgccagcaagatgcgtttgaatttcttctgcacctttttaaacttata
aatgtcaataaacattatgacactcccaatccagttgcatcttttcgttttaatttggag
cagcggttacaatgcctatcatgtggaaaggtgcgatataaaattgacgaacaggataat
atttctgttcctgtcccaattcgtcgcttgaaagaagacaatgatgctgagagttgcgca
agcggagaaacaccggtgtcttcgaaattcgaccgtgtctctctcagggaatgcctcgat
atttttactgcagaagaaattgttgagttaacgtgttctgggtgcgaaagcaagaagggc
ttccgaaagcgatcgctcttcaagacatttccgcaaaacttgattattaacgccagacgg
tttgaactgatcaactgggtgccaactaaacttaatatccccgtcgaagtgagtgacgaa
cccttggatctcagccaatatcgctcgcttggcattcaggcaggcgaaattttattagaa
gatgagccctcacccccagatatcgagtttcaacccaatgaagaagcggttgccatgctt
ctcagtatggggtttcctgagattcggatcaaaaaggcactctatgccacaggaaacacg
gatacggatgccgcattgaattggttgctttcacatatggatgatccggatatcgatacg
acggacatttccgcaccaccaggtagcggtgggaatcactgttcaaatgaagacgaagca
aagattggtcaactaattgacatgggcattgatcgtccgaaagctcggaaagcgctcctt
gaaacggatggagatatcaacagggcgttggattgggttttaagtcatccgtatgacgcg
gagatcgagggatatcaagtaagcagtggatccccagcgcagttgcaaggatctagtgat
atacctgctctctttcaattacacgccatcatctgccacaaaggcgtctcagttcatgct
ggtcactatgttgcatttgtccgaaaagaagttgcccaggatgaagacaaccaatgggtt
cttttcaatgatgaaaaggttgttcaaggtggtgatattgaggagatgaagcaattcgca
tacatctattttttcagaaaattatag

DBGET integrated database retrieval system