KEGG   Coccidioides immitis: CIMG_07314Help
Entry
CIMG_07314        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
cim  Coccidioides immitis
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    CIMG_07314
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    CIMG_07314
Enzymes [BR:cim01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     CIMG_07314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 444 aa AA seqDB search
MVALKALAFGLFLSRVLAVPTPVESSTSPSDTPPTASPSTPEAQAQLEQLSSIAYNVSKS
NLETGSQTKRSGGCSLSNLRVRREWSTFTARQRKSYIDAVLCLQSLPARTPSSIAAGAKT
RYDDFVAVHIQQTLTIHYTGTFLAWHRYFTWQYEQALRNECSYTGAFPYWDWPLSAVIGL
ENHPLFDGSDTSMSGNGEPIPNKGDIFLHLGDLPSIRLPSGTGGGCVTSGPFKNFKVNLG
PAALVLPGDRTEAVANPLDYNPRCLKRDLTDAIVRKFANATAVVDLILRRKTIESFQMNM
QGIPGSGSIGVHGGGHYAMGGDPGRDVFVSPGDPAFFFHHAMIDRVWWIWQNLDLKNRQN
AIHGTGTFLNDPPSPDTTLDTMVDLGYAGGPMLPMRDLMSTINGPFCYVYLLRDTCIKGC
TKRVLPCVTFSARICNGIRMIRST
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggttgccctgaaagccttagccttcgggcttttcctctctcgggtgcttgctgtgcca
acacctgtggaaagcagtacctcgccctcagatactccgcctactgcgtctccctccacc
ccagaggcccaggcccaactcgaacagctgtcgtctatcgcgtacaatgtgagcaagtcg
aatcttgaaactggctcgcagacgaaacgcagcgggggctgcagcttgtcaaatctcaga
gtgcgtcgtgaatggtccacatttacggcaaggcagaggaagagttatatcgatgctgtc
ctttgtctgcagagcttgcccgccaggacgccatccagcattgccgcgggagcaaagact
cgctatgacgatttcgtcgctgtccatatccagcagaccttgaccatccactataccggc
acattccttgcgtggcacaggtatttcacctggcaatacgagcaggctcttcgcaatgag
tgctcctacactggcgccttcccgtactgggattggccgctttcagcagtaattggcctg
gaaaaccatccccttttcgacggcagcgacacgtccatgtctggtaatggggagccgatc
cccaacaagggtgatatttttcttcatctcggagatctaccctcaatccggctgccttcg
ggcactggtggcggatgtgtcactagcggtccattcaagaacttcaaagtgaaccttggc
cccgctgcgctcgtcctcccaggcgacagaaccgaagcggttgctaacccactggactac
aacccccgctgcttgaaacgtgacctcacagatgccatagttcgaaagtttgccaacgct
accgctgttgtggatttgatcctccgcaggaaaactattgaaagtttccagatgaacatg
caaggtattcctgggagcggttccatcggtgttcatggcggcggtcactacgccatgggt
ggcgatccgggccgcgatgtctttgtctcacccggtgatccagcctttttctttcaccat
gcgatgatagatcgcgtgtggtggatctggcagaatttggatctgaagaatcgtcagaat
gcgatccacgggacaggcacattcttgaacgatcccccgtcccctgacacgacactcgac
acgatggttgatctggggtatgcgggtggcccgatgcttccaatgcgcgacctgatgagt
acgataaatgggcccttctgctatgtgtatttgctgagagatacgtgcatcaaaggttgc
acaaagcgcgtgttgccttgtgtaacattctcggcccggatatgtaacggaatacggatg
atcagatcaacctaa

DBGET integrated database retrieval system