KEGG   Coccidioides immitis: CIMG_07321Help
Entry
CIMG_07321        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cim  Coccidioides immitis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cim00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CIMG_07321
Translation factors [BR:cim03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CIMG_07321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 265 aa AA seqDB search
MAPSKWDDEEESTPPSTPPPFVARRKFDDEEDSDEVLDSWDAAEDSEVEREKEAKAAAAK
AKAEAEAAAQRKSKAQRIAEHKARRALDEEESSEEEDAAEQRARLRRTEKESDLKHAQDL
IGDIDLNRNRSAPKATVISDPNDPTKSVDISAMPLFKPGTKAQFTTLTETLAPLLAAQSK
KPQYSIWVQEFTKQLVKELPSSEIKKVASALTAASNEKLKEEKAADKGGKKSKAAKTKTS
LVTTHSNRADLTAYDGDELDDDDFM
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcaaagtgggacgatgaagaggagagcacacctccttccaccccgccgcca
ttcgtggcaagacgcaagtttgacgatgaggaagatagtgacgaggttctagattcctgg
gacgccgccgaagattcggaagtcgagcgagagaaggaagcaaaagcagctgcagctaaa
gccaaggctgaagctgaagccgccgcgcagaggaaatcaaaagcgcaaagaatagcagaa
cataaagcccggcgcgcccttgacgaggaagaatcgagcgaggaggaagatgctgcggaa
cagcgggcgcggctgagacggacggagaaggagtccgatctgaagcacgcgcaggatctt
atcggcgatatcgatctcaaccggaaccggtcagcgcccaaggcgaccgtcatttctgac
ccgaatgaccctaccaaatctgtcgatatctctgccatgccgctcttcaagccgggaacc
aaggcgcagttcaccactctcacagagaccctcgctcctctactagccgcccaatccaag
aagccgcaatactctatctgggtccaagagtttacgaagcagcttgtaaaggagctcccc
agttcggaaatcaagaaggtggcaagcgctttgaccgccgctagcaacgagaaactcaaa
gaggaaaaggccgctgacaagggcgggaagaagagcaaggcagccaagaccaagacaagt
ctcgtcaccactcactcgaaccgcgcggatctcacagcgtacgatggcgatgagctggac
gatgatgactttatgtga

DBGET integrated database retrieval system