KEGG   Coccidioides immitis: CIMG_07558Help
Entry
CIMG_07558        CDS       T01114                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cim  Coccidioides immitis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cim00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cim00312]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 882 aa AA seqDB search
MDNDELRRQLGQVFAYSYSVVSCEYLPTRPLSKHPELIARFCLQLFIVGFRSLIATDEVK
SLIQAPYYCGTIILFQRNIESAEQLIALINDLQQTARDAGHTRPLFIAVDQENGLVTRIK
PPIATQLPGAMAVGATGDIDDAIRVSTATGEILDALGINMNYAPLCDVNSEPANPVIGVR
SPGDDGTFVGRITSNIAKGLRKNSIVPCAKHFPGHGSTKVDSHYGVPVVRKPKEDLEACE
LLPFRRAVAEGIEAIMTSHVVMSAFDDAGLPSSVSKDVVNFLRRGLQHEGLIITDCLEMD
AIRVQIGTEKGAVRALAAGVDCAMICHTYDVQVRALEEAFNACKIGTIPLRQISQSVSRV
HALKDKFFDWDSVFRHRSVNTVTQLNLKHQELANDIYARSVTVIRDDQKALPLSRGGSLV
YVYPCGKALRVGASGSGETVTCVPYTPPEFSQILKLFVPDLIECPFFDDATLDESTKSKI
SQADAVILASRNCRLNPSQRLIGTQLVNHSKKLVSIATCVPYDFLNSGIKTCLAMYEPTV
EAFQAAANVIFGVNEGVGKLPVCTKRPPLPIDSFDPERDMKLAINLWHMLLPHYAVPADR
LHHLLDRPNGKHFTIYVEDQLAGFIATYVNEDRPTAYISVLLVHPKFRSRGVGTALVEHA
RRQLRGAARSVTIGSSFPRFFLGVPLDIPEEAQNFFIHRGFVPTRGPSSRDYTADLRTYQ
PPEGVLQRAAAAGVTFTPWRINLYLECMANIRELWGDDEVWLGAYERLARQNRHEQVMVA
MDRSGKQIGWTLMQELGLGMTNDLAFMPLLGQKTGQIGCLGIHPDARNKGVGLALVVSAA
MDMKGRGLEKVFVDWTNHVNFYEKAGFEVWREYRSMTLKESV
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgacgagttacgcaggcagcttggccaggtatttgcctactcctactccgta
gttagctgcgaatatctgccaacccgtcccctgtcaaaacaccctgagctaatcgcccgt
ttctgtttacagctgttcatcgtcggcttccggtcgctgatcgccacagacgaggtcaaa
tcgctcatccaggccccatactactgcggcaccatcattctcttccagcggaacattgag
agtgcggaacaactgattgccctcataaatgaccttcagcagacggcaagggatgctggc
cacacccgcccacttttcattgctgtcgaccaggaaaacggccttgtcacccggattaag
cctcccattgccacccagctgcccggtgctatggcagttggcgccaccggtgacatagac
gatgccatccgcgtctccactgccacaggtgaaatactggatgctctaggcatcaacatg
aattatgctccgctgtgcgacgtcaactcagagccggccaaccccgtcatcggtgtccga
tctccgggcgatgacgggaccttcgtcggcagaatcacgagcaatattgccaaaggactg
aggaagaacagcatcgtaccctgtgcaaagcacttcccaggacacggaagcacaaaagtt
gattcccactacggtgttcctgtcgttaggaaacccaaagaggatcttgaagcatgtgaa
ctccttccgtttcgcagagcagtcgctgaggggatcgaggccataatgacctcccacgtt
gttatgtcagccttcgatgacgctggattgccatcctccgtcagcaaagatgttgtaaat
ttcctgcgtcgaggcctacagcatgaaggtctcatcatcactgactgtcttgaaatggat
gctatacgcgtgcagatcgggaccgaaaagggggccgtccgggccttagctgcgggtgtc
gattgcgcgatgatatgtcacacttatgatgtccaagttcgagcacttgaagaggcattc
aatgcttgcaagattggcactattccacttcgtcagatctcccagtccgtttcacgggtt
cacgccttgaaggataagttctttgattgggactcagtttttcgccaccgctcagttaac
accgttacccaactaaacttgaagcaccaggaactggcaaacgatatctacgcccggagc
gtcactgttatcagggatgaccagaaagcgctccctctgtccaggggagggtccttggtc
tacgtctatccttgtgggaaagctctccgtgtgggtgcttctggaagcggcgaaacggtc
acctgtgttccttacacaccaccggaattctcacaaattttgaaactctttgtcccggat
ctgatcgaatgtcccttttttgatgacgcaactctagatgaaagcacaaaatccaagatc
tcacaggccgacgccgtgattttggcctcgcggaactgcaggttgaatccaagccaaaga
ctgataggcactcagcttgtgaatcattcaaaaaaattagtcagcattgctacatgtgtt
ccatatgatttcctaaactcagggattaaaacttgtcttgccatgtacgaaccgaccgtt
gaggccttccaagcggcggccaatgtcatcttcggggttaatgagggggtaggaaagctt
cctgtttgtacaaaacgcccgccactccccatagattcttttgatccggagcgtgacatg
aaactggcgataaacctatggcatatgttactcccccactatgctgtccctgcagaccgt
ttgcatcatcttctcgatcgcccaaacgggaaacattttacaatttacgtggaagaccaa
cttgcaggttttatagctacctatgttaatgaagatagacccacggcatacatttccgtt
ctccttgttcacccgaagtttcggtcgcgcggggttggaacagccttggttgagcatgct
cggcgtcagttgcgtggagcagctcgttccgtcacaataggttcgagcttccctagattt
ttccttggcgtccccctagatataccagaagaggcccagaatttttttatccatcgtggt
ttcgttccgaccagaggcccctcgtcgagagactacacggcggacctaaggacctatcaa
cccccagaaggagttcttcagcgtgccgccgcggcaggcgtaacattcactccttggaga
ataaatctgtatcttgaatgtatggctaacatacgtgagctctggggtgatgatgaagtc
tggcttggtgcatacgagcgtctggcacggcagaaccgacacgaacaagtcatggtggcg
atggatcgttccggaaaacaaatagggtggactctgatgcaagaactaggtctaggtatg
accaacgatcttgcctttatgccgttactaggccagaaaaccggccagattggctgtctg
ggtattcatcccgatgcgaggaataaaggtgtgggtctagccttggttgtgagcgctgca
atggatatgaaggggcgaggcttagagaaggtatttgttgattggacgaatcatgtcaat
ttttatgaaaaagcgggatttgaggtgtggagggagtatcgatcaatgactctgaaagag
tccgtgtag

DBGET integrated database retrieval system