KEGG   Coccidioides immitis: CIMG_07558Help
Entry
CIMG_07558        CDS       T01114                                 

Definition
(RefSeq) beta-N-acetylglucosaminidase
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cim  Coccidioides immitis
Pathway
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cim00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CIMG_07558
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CIMG_07558
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CIMG_07558
Enzymes [BR:cim01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CIMG_07558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 850 aa AA seqDB search
MDNDELRRQLGQLFIVGFRSLIATDEVKSLIQAPYYCGTIILFQRNIESAEQLIALINDL
QQTARDAGHTRPLFIAVDQENGLVTRIKPPIATQLPGAMAVGATGDIDDAIRVSTATGEI
LDALGINMNYAPLCDVNSEPANPVIGVRSPGDDGTFVGRITSNIAKGLRKNSIVPCAKHF
PGHGSTKVDSHYGVPVVRKPKEDLEACELLPFRRAVAEGIEAIMTSHVVMSAFDDAGLPS
SVSKDVVNFLRRGLQHEGLIITDCLEMDAIRVQIGTEKGAVRALAAGVDCAMICHTYDVQ
VRALEEAFNACKIGTIPLRQISQSVSRVHALKDKFFDWDSVFRHRSVNTVTQLNLKHQEL
ANDIYARSVTVIRDDQKALPLSRGGSLVYVYPCGKALRVGASGSGETVTCVPYTPPEFSQ
ILKLFVPDLIECPFFDDATLDESTKSKISQADAVILASRNCRLNPSQRLIGTQLVNHSKK
LVSIATCVPYDFLNSGIKTCLAMYEPTVEAFQAAANVIFGVNEGVGKLPVCTKRPPLPID
SFDPERDMKLAINLWHMLLPHYAVPADRLHHLLDRPNGKHFTIYVEDQLAGFIATYVNED
RPTAYISVLLVHPKFRSRGVGTALVEHARRQLRGAARSVTIGSSFPRFFLGVPLDIPEEA
QNFFIHRGFVPTRGPSSRDYTADLRTYQPPEGVLQRAAAAGVTFTPWRINLYLECMANIR
ELWGDDEVWLGAYERLARQNRHEQVMVAMDRSGKQIGWTLMQELGLGMTNDLAFMPLLGQ
KTGQIGCLGIHPDARNKGVGLALVVSAAMDMKGRGLEKVFVDWTNHVNFYEKAGFEVWRE
YRSMTLKESV
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgacgagttacgcaggcagcttggccagctgttcatcgtcggcttccggtcg
ctgatcgccacagacgaggtcaaatcgctcatccaggccccatactactgcggcaccatc
attctcttccagcggaacattgagagtgcggaacaactgattgccctcataaatgacctt
cagcagacggcaagggatgctggccacacccgcccacttttcattgctgtcgaccaggaa
aacggccttgtcacccggattaagcctcccattgccacccagctgcccggtgctatggca
gttggcgccaccggtgacatagacgatgccatccgcgtctccactgccacaggtgaaata
ctggatgctctaggcatcaacatgaattatgctccgctgtgcgacgtcaactcagagccg
gccaaccccgtcatcggtgtccgatctccgggcgatgacgggaccttcgtcggcagaatc
acgagcaatattgccaaaggactgaggaagaacagcatcgtaccctgtgcaaagcacttc
ccaggacacggaagcacaaaagttgattcccactacggtgttcctgtcgttaggaaaccc
aaagaggatcttgaagcatgtgaactccttccgtttcgcagagcagtcgctgaggggatc
gaggccataatgacctcccacgttgttatgtcagccttcgatgacgctggattgccatcc
tccgtcagcaaagatgttgtaaatttcctgcgtcgaggcctacagcatgaaggtctcatc
atcactgactgtcttgaaatggatgctatacgcgtgcagatcgggaccgaaaagggggcc
gtccgggccttagctgcgggtgtcgattgcgcgatgatatgtcacacttatgatgtccaa
gttcgagcacttgaagaggcattcaatgcttgcaagattggcactattccacttcgtcag
atctcccagtccgtttcacgggttcacgccttgaaggataagttctttgattgggactca
gtttttcgccaccgctcagttaacaccgttacccaactaaacttgaagcaccaggaactg
gcaaacgatatctacgcccggagcgtcactgttatcagggatgaccagaaagcgctccct
ctgtccaggggagggtccttggtctacgtctatccttgtgggaaagctctccgtgtgggt
gcttctggaagcggcgaaacggtcacctgtgttccttacacaccaccggaattctcacaa
attttgaaactctttgtcccggatctgatcgaatgtcccttttttgatgacgcaactcta
gatgaaagcacaaaatccaagatctcacaggccgacgccgtgattttggcctcgcggaac
tgcaggttgaatccaagccaaagactgataggcactcagcttgtgaatcattcaaaaaaa
ttagtcagcattgctacatgtgttccatatgatttcctaaactcagggattaaaacttgt
cttgccatgtacgaaccgaccgttgaggccttccaagcggcggccaatgtcatcttcggg
gttaatgagggggtaggaaagcttcctgtttgtacaaaacgcccgccactccccatagat
tcttttgatccggagcgtgacatgaaactggcgataaacctatggcatatgttactcccc
cactatgctgtccctgcagaccgtttgcatcatcttctcgatcgcccaaacgggaaacat
tttacaatttacgtggaagaccaacttgcaggttttatagctacctatgttaatgaagat
agacccacggcatacatttccgttctccttgttcacccgaagtttcggtcgcgcggggtt
ggaacagccttggttgagcatgctcggcgtcagttgcgtggagcagctcgttccgtcaca
ataggttcgagcttccctagatttttccttggcgtccccctagatataccagaagaggcc
cagaatttttttatccatcgtggtttcgttccgaccagaggcccctcgtcgagagactac
acggcggacctaaggacctatcaacccccagaaggagttcttcagcgtgccgccgcggca
ggcgtaacattcactccttggagaataaatctgtatcttgaatgtatggctaacatacgt
gagctctggggtgatgatgaagtctggcttggtgcatacgagcgtctggcacggcagaac
cgacacgaacaagtcatggtggcgatggatcgttccggaaaacaaatagggtggactctg
atgcaagaactaggtctaggtatgaccaacgatcttgcctttatgccgttactaggccag
aaaaccggccagattggctgtctgggtattcatcccgatgcgaggaataaaggtgtgggt
ctagccttggttgtgagcgctgcaatggatatgaaggggcgaggcttagagaaggtattt
gttgattggacgaatcatgtcaatttttatgaaaaagcgggatttgaggtgtggagggag
tatcgatcaatgactctgaaagagtccgtgtag

DBGET integrated database retrieval system