KEGG   Coccidioides immitis: CIMG_07588Help
Entry
CIMG_07588        CDS       T01114                                 

Definition
(RefSeq) TTK protein kinase
  KO
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
cim  Coccidioides immitis
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:cim00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CIMG_07588
Enzymes [BR:cim01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CIMG_07588
Protein kinases [BR:cim01001]
 Serine/threonine protein kinases: Other group
  TTK family
   CIMG_07588
Chromosome [BR:cim03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     CIMG_07588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 861 aa AA seqDB search
MTLTASPTPLPSGQRSASNRQRPASLHDLHRRTVSRHIGSNGSPHGNSVEIGNMAEDLAR
SRAISAGDSSDDDDFPEPIKFSASVKALLGEDASGLDTSPRRGTRDGSENQPYQRADGRR
QHVKQVRIASPDQRASASPPLRIVRLGSESRRSPSSLGGEASILSGRGEREYHVPEGNRD
DFITPAPRTRSVRIATGSRSTTRSPSASLPSANGGSSSDASRVEERSFLEDGMKSGQDDR
SYARAGMGTVPRTRAEVETGIQGSLRVKRVGKLSGSFLNGPARRGVLRRQSEEEPRAEHQ
EESFLDSGSRNRYEESQEPSPLEDSMLRNKRSFESRRESPRFSDNNVGASLSRTPQSIPI
RQRSLRNSGSGSVSALESGSPRSHHLNSSSGSRQRRSPNVDINPVYRVPSPPELPAKHDQ
ENGPPPTFKRSKPEGFGLLNKIEKFSVLHEEDKGAIKAAPETVSPRKPLGKVSNNTPRRP
APPPPPKMSVLETATAVAGAASSSQSKRKRAQVSINRKVYTRLDCIGRGGSSRVYRVMAE
NCKIFALKRVHLEDVDPHALAGYKGEIDLLKKLRNVGRVVQLFDWEINEEKHALSVLMEM
GESDLHRILTRKLNTEDAVFDPVFARFYWKEMLECVQAVHDFDIVHSDLKPANFLLVHGR
LKLIDFGIANTIQDHTVNVHREQQIGTPNYMAPEALIDCNAALGLPATAGKMMKLGKPSD
VWSLGCILYQMVYGKAPFAHIAKPLERIMAIPNPRVPINYPPVGVGNVSVPSNVLRTLKE
CLQRDQALRPTIKQLLSPNDPFLYPETHLEGTVPITEEMLGRILTNVVNHCRARGPPTAQ
ELAGWPAGFFTKIKAAMEEDR
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgacccttactgcctcccctacgccattgccttcgggccagaggagtgcgagtaatcgc
cagcggccagcatcactacatgatctccaccgcagaacggtatcaagacatatcggcagc
aacggatcgccacatgggaattcggtggagattgggaacatggctgaagatttagcgcga
tcgagggcgatttcggcgggagatagctcagacgacgatgattttccagagcccatcaag
ttcagcgcgtcggtgaaggcgttgctaggggaggatgcgtcgggattggacacgtcgccg
agaagaggcaccagagacggatcggaaaatcaaccttatcagagggcggacggtcgaaga
cagcatgtgaagcaggtcagaattgcgtcgccagatcagcgggccagcgcgagtcccccg
ctgaggattgttcgtcttggatcggagtcgcgccgctcaccgagttcgcttgggggagaa
gcctcgattttgtcaggaagaggagagagggagtatcatgtccctgaggggaatcgcgat
gattttatcaccccggcaccgcggacaagaagtgttaggattgcgacaggttcgaggagc
acgactcgctctccgtcagcatcactaccgtcagccaatggaggctcatctagcgatgct
agtagggttgaggagcggtcctttttggaggatggcatgaagagcggccaagacgaccgt
agttatgctcgagctgggatgggaacggtaccccgaacaagggcggaagtcgagactgga
attcagggttctctacgagtgaagcgtgtgggcaaattgtcaggttcctttcttaatggt
cctgcaaggagaggcgtcctccggcgccagagtgaggaagagccgcgcgccgagcatcag
gaagaatcattccttgattctggatctcgcaacagatatgaagaatctcaggaaccgtcg
ccattggaagattctatgctacggaataagcggtcctttgagagccggcgcgaatctcca
cgattttcagacaacaatgttggcgcgtcattatctcgaactcctcaatccataccaatc
cgacaacgatcgctccgaaacagtgggagtgggagtgtgagcgcgttggaaagtggctcc
cctcgttcccatcatctcaattcctcgtctggatcccggcagcgccggtcaccaaacgtc
gatattaatccagtatatcgtgtgccttcgccgccggagctaccggcaaaacatgatcag
gagaatggtccaccgcctacatttaagaggagtaaacctgaagggtttggactgctaaac
aaaatcgagaagttctcagttctacatgaggaggacaaaggcgccatcaaggccgcgcca
gagacagtatccccacggaagccactagggaaagtcagcaacaatacccctcgccgacct
gctccgcctcctccacctaaaatgagtgtgctggaaaccgctaccgccgttgccggggcc
gccagctcctcgcaatctaagagaaagcgagcgcaagtatctatcaaccgaaaggtctat
acacgactagactgcataggccgtggtggtagttcacgagtctaccgcgtgatggctgaa
aactgtaagatatttgcgcttaagcgggtgcacctagaggatgtcgatccccatgcattg
gctggctacaaaggagaaatcgatcttttgaagaagctgcggaatgtcgggcgcgtcgtt
caactgttcgattgggagatcaacgaggagaaacatgcactaagcgttcttatggagatg
ggagaatcggatctccatcggatccttacgcgcaaattgaataccgaggatgctgttttc
gatccggtctttgctcgattctactggaaagagatgctggaatgcgtgcaagctgtacac
gactttgacattgtccattccgatctcaaacctgcgaatttcctcctggttcatggcagg
ctcaagcttatcgattttgggattgcgaatactatccaagaccacactgtcaatgtgcac
cgcgaacagcaaataggaactccgaactacatggctcctgaagctcttatcgattgcaac
gctgcccttggtcttcctgccactgctggaaaaatgatgaaattgggcaaaccgagtgat
gtgtggagcttggggtgcatactctatcagatggtctacggcaaagcgccttttgcccat
atcgccaagccccttgaacggatcatggctattcccaatcctagagtaccgatcaattat
cctccagtcggcgtgggtaacgtatccgtgccatcaaacgttctgcgaacgttgaaggag
tgtctgcaacgcgatcaggcacttaggccaacgataaagcaattactcagccctaacgat
ccgttcttgtatccggagacacatttggagggtacggttcctataaccgaggagatgctg
ggcaggatattgactaacgttgtcaatcattgccgtgctcgaggacctcccacagcccaa
gaattggcggggtggccggctgggttctttacaaagattaaagctgccatggaagaggat
agatga

DBGET integrated database retrieval system